powered by:
Protein Alignment Ubi-p5E and Oas1d
DIOPT Version :9
Sequence 1: | NP_001284937.1 |
Gene: | Ubi-p5E / 326237 |
FlyBaseID: | FBgn0086558 |
Length: | 534 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_598654.1 |
Gene: | Oas1d / 100535 |
MGIID: | 2140770 |
Length: | 361 |
Species: | Mus musculus |
Alignment Length: | 68 |
Identity: | 14/68 - (20%) |
Similarity: | 22/68 - (32%) |
Gaps: | 23/68 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 58 DYNIQKESTLHLVLRLRGGMQIFVK--------------------TLTG---KTITLEVEPSDTI 99
:|.|.:...||.....|..:::..| .|.| |...|.::|:|..
Mouse 247 EYGIHENPGLHTAQCFRTVLELVTKYKRLRIYWTWCYDFQHEISDYLQGQIKKARPLILDPADPT 311
Fly 100 ENV 102
.||
Mouse 312 RNV 314
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5272 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.