DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubi-p5E and zfand4

DIOPT Version :9

Sequence 1:NP_001284937.1 Gene:Ubi-p5E / 326237 FlyBaseID:FBgn0086558 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_001189400.1 Gene:zfand4 / 100148477 ZFINID:ZDB-GENE-090312-102 Length:673 Species:Danio rerio


Alignment Length:474 Identity:110/474 - (23%)
Similarity:178/474 - (37%) Gaps:143/474 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP 114
            :.|.|....:|......||..|.....|::|::||||....|.|.|.:.:.:||||||..||||.
Zfish     1 MTDKRNPPFFNDDNVGVLHYKLPFSETMELFIETLTGTCFQLRVSPFEQVVSVKAKIQRLEGIPV 65

  Fly   115 DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG-MQIFVKTLTGKTITLEVEPSDTIENV 178
            .||.||:.|.:|||...|.||:|.:..||.|||.:||| :.....|:|..::.   :.||.::..
Zfish    66 SQQHLIWNGMELEDEYCLHDYSITEGCTLKLVLAMRGGPVNTRRVTVTDDSVR---DISDCLDAG 127

  Fly   179 KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTI-T 242
            :.::.:| .:|..|...:.    ..:|..|:.:.:        |.|..|.:....::|:|.:: .
Zfish   128 REEMWEK-SLPNKQVTFLV----YREGDQLNFFRV--------VDRGDGTLTPVSESLSGASVRN 179

  Fly   243 LEVEPSDTIENVKAKIQDKE-GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQ 306
            :..|..:..|:..:::|..| .|...:.:|:.|        .:.:.|:.|:..            
Zfish   180 VRAEEEEEQESASSELQTLENSITMGKMKLLKA--------KMENMNLNKKPK------------ 224

  Fly   307 IFVKTLTGKTITLEVEP-----------SDTIENVKAKIQDKEG------IPP--DQQRLIF--- 349
                    ||..|::.|           .....:...::..:.|      :||  |||:.:.   
Zfish   225 --------KTAKLKIRPPVGPRPCSGSHGSARHHRMFRVLPQIGHASSTHLPPIGDQQQPVLSTP 281

  Fly   350 -AGKQLEDGRTLSD----------------YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV 397
             ||...:...:||.                |.:|.|                             
Zfish   282 TAGSAHQPYTSLSSPASSSRAHPSSAASGIYMLQAE----------------------------- 317

  Fly   398 EPSDTIENVKAKIQDKEGIPPDQQRLIFAG-KQLEDG-----RTLSDYNIQKESTL---HLVLRL 453
            ||.|  ..|..||:    :||...||...| |.:.|.     ..||...:|.|..:   ||    
Zfish   318 EPWD--NPVPRKIR----LPPKVSRLDMRGPKVMRDCVYPPLSLLSSPGVQDEVDIKNEHL---- 372

  Fly   454 RGGMQIFVKTLTGKTITLE 472
                     |||.||..:|
Zfish   373 ---------TLTEKTTVIE 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubi-p5ENP_001284937.1 Ubiquitin 1..76 CDD:176398 6/25 (24%)
UBQ 1..72 CDD:214563 5/21 (24%)
Ubiquitin 77..152 CDD:176398 37/74 (50%)
UBQ 77..148 CDD:214563 35/70 (50%)
Ubiquitin 153..228 CDD:176398 11/74 (15%)
UBQ 153..224 CDD:214563 10/70 (14%)
Ubiquitin 229..304 CDD:176398 11/76 (14%)
UBQ 229..300 CDD:214563 11/72 (15%)
Ubiquitin 305..380 CDD:176398 17/113 (15%)
UBQ 305..376 CDD:214563 17/109 (16%)
Ubiquitin 381..456 CDD:176398 19/83 (23%)
UBQ 381..452 CDD:214563 19/79 (24%)
Ubiquitin 457..532 CDD:176398 6/16 (38%)
UBQ 457..528 CDD:214563 6/16 (38%)
zfand4NP_001189400.1 AN1_N 1..103 CDD:176397 43/101 (43%)
UBQ 28..99 CDD:214563 35/70 (50%)
ZnF_AN1 613..651 CDD:197545
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.