Sequence 1: | NP_727348.2 | Gene: | Cubn / 326235 | FlyBaseID: | FBgn0052702 | Length: | 3750 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_445834.1 | Gene: | Tnfaip6 / 84397 | RGDID: | 621359 | Length: | 275 | Species: | Rattus norvegicus |
Alignment Length: | 262 | Identity: | 64/262 - (24%) |
---|---|---|---|
Similarity: | 105/262 - (40%) | Gaps: | 56/262 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 840 ARAGSFQLNY---RMACDYKLNNEQGTITSPGYPNLTRSDRICTYTISTATNTVISLKRIDFQLT 901
Fly 902 NGESDDDDNDECLTTNLRINDGLNRKILGPYCGKNQPEENFVSETNYLQLHLSTDVDSMGRGFKF 966
Fly 967 EYRALATGNDKCGGVHTRSGDHIRLPVHDDSYAGEATCYWVIMAPANKAIRLHWNSFSLENAVDC 1031
Fly 1032 IYDYLEIYDSLGAQVNDERSKPLAKYCGNSVPEDLLSHSRQLVLKFVSDYSESDGGFDLTYTFED 1096
Fly 1097 RA 1098 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cubn | NP_727348.2 | EGF_CA | 156..190 | CDD:238011 | |
EGF_CA | 192..233 | CDD:238011 | |||
EGF_CA | 282..322 | CDD:214542 | |||
EGF_3 | 328..366 | CDD:289699 | |||
EGF | 430..457 | CDD:278437 | |||
EGF_CA | 469..503 | CDD:238011 | |||
CUB | 509..622 | CDD:238001 | |||
CUB | 627..737 | CDD:238001 | |||
CUB | 744..849 | CDD:294042 | 5/8 (63%) | ||
CUB | 853..970 | CDD:238001 | 14/116 (12%) | ||
CUB | 978..1094 | CDD:238001 | 42/115 (37%) | ||
CUB | 1100..1211 | CDD:238001 | |||
CUB | 1216..1330 | CDD:238001 | |||
CUB | 1446..1549 | CDD:238001 | |||
CUB | 1554..1667 | CDD:238001 | |||
CUB | 1792..1899 | CDD:238001 | |||
CUB | 1910..1998 | CDD:294042 | |||
CUB | 2019..2133 | CDD:238001 | |||
CUB | 2140..2242 | CDD:238001 | |||
CUB | 2263..2379 | CDD:238001 | |||
CUB | 2385..2511 | CDD:238001 | |||
CUB | 2516..2630 | CDD:238001 | |||
CUB | <2833..2892 | CDD:294042 | |||
CUB | 2898..3008 | CDD:238001 | |||
CUB | 3011..3127 | CDD:238001 | |||
CUB | 3130..3241 | CDD:238001 | |||
CUB | 3254..3363 | CDD:238001 | |||
CUB | 3379..3508 | CDD:238001 | |||
CUB | 3531..3601 | CDD:294042 | |||
CUB | 3623..3733 | CDD:238001 | |||
Tnfaip6 | NP_445834.1 | Link_domain_TSG_6_like | 36..128 | CDD:239592 | 20/133 (15%) |
CUB | 135..244 | CDD:395345 | 41/113 (36%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |