DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cubn and MFRP

DIOPT Version :9

Sequence 1:NP_727348.2 Gene:Cubn / 326235 FlyBaseID:FBgn0052702 Length:3750 Species:Drosophila melanogaster
Sequence 2:NP_113621.1 Gene:MFRP / 83552 HGNCID:18121 Length:579 Species:Homo sapiens


Alignment Length:413 Identity:98/413 - (23%)
Similarity:155/413 - (37%) Gaps:108/413 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   978 CGGVHTRSGDHIRLPVHDDSYAGEATCYWVIMAPANKAIRLHWNSFSLENAVDCIYDYLEIYDSL 1042
            |||:.:........|.:.|.|.....|.|.|....:.||:|...:.|:|:...|::|.||:    
Human   144 CGGLLSGPRGFFSSPNYPDPYPPNTHCVWHIQVATDHAIQLKIEALSIESVASCLFDRLEL---- 204

  Fly  1043 GAQVNDERSKPLAKYCGNSVPEDLLSHSRQLVLKFVSDYSESDGGFDLTYT-------------- 1093
                :.|...||.:.||...|..|.:::..|::.||||.|....||...|.              
Human   205 ----SPEPEGPLLRVCGRVPPPTLNTNASHLLVVFVSDSSVEGFGFHAWYQAMAPGRGSCAHDEF 265

  Fly  1094 ----------------FEDRAK-------------CGGHIHASSGELTSPEYPANYSAGLDCDWH 1129
                            |.:.|.             |||::....|..::|.|...|...|.|.||
Human   266 RCDQLICLLPDSVCDGFANCADGSDETNCSAKFSGCGGNLTGLQGTFSTPSYLQQYPHQLLCTWH 330

  Fly  1130 LTGTIDHLLEIQVENFELEQSPNCSADYLEV--RNGGGTDSPLIGRFCGRDIPARIPGFSHEMRL 1192
            ::....|.:|:|..||.||....|..||:||  .:..|..| |:|||||.:.|..:....||:.:
Human   331 ISVPAGHSIELQFHNFSLEAQDECKFDYVEVYETSSSGAFS-LLGRFCGAEPPPHLVSSHHELAV 394

  Fly  1193 ILHTDSAINGRGFRLRWRIF---------------AFGCGG----------SLRSNMGAISSPRY 1232
            :..||..|:..||...:..|               |.||.|          ....:....|.|.:
Human   395 LFRTDHGISSGGFSATYLAFNATENPCGPSELSCQAGGCKGVQWMCDMWRDCTDGSDDNCSGPLF 459

  Fly  1233 PNSYPNMAHCE-----------WRISLHPGSGISLLIEDLELEGLSN--------CYYDSVKIYT 1278
            |.  |.:| ||           :..:..|...:.::.::..:|.||.        ||....::..
Human   460 PP--PELA-CEPVQVEMCLGLSYNTTAFPNIWVGMITQEEVVEVLSGYKSLTSLPCYQHFRRLLC 521

  Fly  1279 GIKLPNQS-------PCKVLCKD 1294
            |:.:|..:       ||:.:|::
Human   522 GLLVPRCTPLGSVLPPCRSVCQE 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CubnNP_727348.2 EGF_CA 156..190 CDD:238011
EGF_CA 192..233 CDD:238011
EGF_CA 282..322 CDD:214542
EGF_3 328..366 CDD:289699
EGF 430..457 CDD:278437
EGF_CA 469..503 CDD:238011
CUB 509..622 CDD:238001
CUB 627..737 CDD:238001
CUB 744..849 CDD:294042
CUB 853..970 CDD:238001
CUB 978..1094 CDD:238001 34/145 (23%)
CUB 1100..1211 CDD:238001 39/112 (35%)
CUB 1216..1330 CDD:238001 20/115 (17%)
CUB 1446..1549 CDD:238001
CUB 1554..1667 CDD:238001
CUB 1792..1899 CDD:238001
CUB 1910..1998 CDD:294042
CUB 2019..2133 CDD:238001
CUB 2140..2242 CDD:238001
CUB 2263..2379 CDD:238001
CUB 2385..2511 CDD:238001
CUB 2516..2630 CDD:238001
CUB <2833..2892 CDD:294042
CUB 2898..3008 CDD:238001
CUB 3011..3127 CDD:238001
CUB 3130..3241 CDD:238001
CUB 3254..3363 CDD:238001
CUB 3379..3508 CDD:238001
CUB 3531..3601 CDD:294042
CUB 3623..3733 CDD:238001
MFRPNP_113621.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..143
CUB 144..252 CDD:238001 34/115 (30%)
LDLa 260..294 CDD:238060 2/33 (6%)
CUB 301..411 CDD:238001 39/110 (35%)
LDLa 421..454 CDD:238060 4/32 (13%)
Fz 466..569 CDD:279700 13/79 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4292
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.