DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cubn and SCUBE2

DIOPT Version :9

Sequence 1:NP_727348.2 Gene:Cubn / 326235 FlyBaseID:FBgn0052702 Length:3750 Species:Drosophila melanogaster
Sequence 2:NP_001354906.1 Gene:SCUBE2 / 57758 HGNCID:30425 Length:1028 Species:Homo sapiens


Alignment Length:1207 Identity:247/1207 - (20%)
Similarity:373/1207 - (30%) Gaps:459/1207 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 EANSCASG--PCENGGTCYNTYTGFRCQCRSAF--EGTKCEMDVNECALYEGTDL--GC------ 206
            :.:.||.|  .|.....|.||.|.::|.|:..:  ||.:|| |::||    |.:|  ||      
Human    45 DVDECAQGLDDCHADALCQNTPTSYKCSCKPGYQGEGRQCE-DIDEC----GNELNGGCVHDCLN 104

  Fly   207 -----------------------------QNGGQCQ----NHFGTYSCLCQPGW----------- 227
                                         :|.|.||    |..|:|.|.|:.|:           
Human   105 IPGNYRCTCFDGFMLAHDGHNCLDVDECLENNGGCQHTCVNVMGSYECCCKEGFFLSDNQHTCIH 169

  Fly   228 ---HGMHCTQRKADCSQ--------SSAWE----------------LCGHGS--CVPSADDA--G 261
               .|:.|..:...||.        |.|.|                .|.||:  |..|.||.  |
Human   170 RSEEGLSCMNKDHGCSHICKEAPRGSVACECRPGFELAKNQRDCILTCNHGNGGCQHSCDDTADG 234

  Fly   262 YRCICEPGWK--TNGLTPICGED-VDECSDS----------------------AAHKPCSTSCIN 301
            ..|.|.|.:|  |:|.:.:..|| |.|.::|                      ..:..|..:|.:
Human   235 PECSCHPQYKMHTDGRSCLEREDTVLEVTESNTTSVVDGDKRVKRRLLMETCAVNNGGCDRTCKD 299

  Fly   302 LPGSFTCAPCPAGLT--GNGVSCRDLDECQTNNGGCSLSPKVDCINTYGSYHCGECPVGW--TGD 362
            ......|: ||.|.|  .:|.:|:|:|||||.||||...    |.|..||:.|| |..|:  ..|
Human   300 TSTGVHCS-CPVGFTLQLDGKTCKDIDECQTRNGGCDHF----CKNIVGSFDCG-CKKGFKLLTD 358

  Fly   363 GRKCERSPQDIDIPAGQTPRTCPAGNNPCYPTASCFLISGTTSCRCPMGMVGTGYGPNGCVNGTT 427
            .:.|    ||:|  .....|||         ..||....||.:|.|..|.  |.||...|  |.|
Human   359 EKSC----QDVD--ECSLDRTC---------DHSCINHPGTFACACNRGY--TLYGFTHC--GDT 404

  Fly   428 TNCKENPCLNGG---ICLFAGPSNYTCLCPIGFR---------------PPICEPQPSPCDQHPC 474
            ..|..|   |||   :|:.. ..:|.|.|..|::               |....|:.|   .|..
Human   405 NECSIN---NGGCQQVCVNT-VGSYECQCHPGYKLHWNKKDCVEVKGLLPTSVSPRVS---LHCG 462

  Fly   475 KNGGRCRPTTSGDLFVCQCLPGYRGRLCETRFSSCNGMLSAQSGRLRYPPEGTGYEHNAQCAWVI 539
            |:||       ||....:|..|..      ..|...|..|...|      ..:...:..|     
Human   463 KSGG-------GDGCFLRCHSGIH------LSSGLQGAYSVTCG------SSSPLRNKQQ----- 503

  Fly   540 RTNESLVVNVTFNSFDVEDSTECRFDWLQINDGRSAA--AQIIGRYCGNHLPHGGNIVSSGNQLY 602
            ::|:|...:||.....|.         .::|:|:.:.  |::........||             
Human   504 KSNDSAFGDVTTIRTSVT---------FKLNEGKCSLKNAELFPEGLRPALP------------- 546

  Fly   603 LWFRSDNSTAKEGF---DLTWNSMEPQCGGRLNFETHGTLASPGSPGNYPKNRDCRWQLVAPTT- 663
                ..:|:.||.|   :||.:|     |.::          ||:||.             |:| 
Human   547 ----EKHSSVKESFRYVNLTCSS-----GKQV----------PGAPGR-------------PSTP 579

  Fly   664 KRIKLTF-FSLQLEQH---ANCNFDYVLIKDSISGRELAKYCTTGAPAPLLLPTHLAEIHFHSDA 724
            |.:.:|. |.|:..|.   |:|:...::.:   :.:.|.|...|     |....|..:.|.....
Human   580 KEMFITVEFELETNQKEVTASCDLSCIVKR---TEKRLRKAIRT-----LRKAVHREQFHLQLSG 636

  Fly   725 EGSDTGFQLHYSVEERVPGCGGVYTAKEGTISESSTANTEPGGVSCEYEIHLAVGEQVVIQFARL 789
            ...|...:...:.|.:...||            ....:.|...|||....:.....:..|     
Human   637 MNLDVAKKPPRTSERQAESCG------------VGQGHAENQCVSCRAGTYYDGARERCI----- 684

  Fly   790 ELDPLDCLEVLDITDEGGSILQEKICGSDASRLNPPTFTSEFNRLKIKFYARAGSFQLNYRMACD 854
                                    :|.:.       ||.:|..::..:...|.|:          
Human   685 ------------------------LCPNG-------TFQNEEGQMTCEPCPRPGN---------- 708

  Fly   855 YKLNNEQGTITSPGYPNLTRSDRICTYTISTATNTVISLKRIDFQLTNGESDDDDNDECLTTNLR 919
                  .|.:.:|...|::....:|                     ..||...|....|....| 
Human   709 ------SGALKTPEAWNMSECGGLC---------------------QPGEYSADGFAPCQLCAL- 745

  Fly   920 INDGLNRKILGPYCGKNQPEENFVSETNYLQLHLSTDVDSMGRGFKFEYRALATGND-----KCG 979
                          |..|||..            .|.....|.|...:::...:..|     :|.
Human   746 --------------GTFQPEAG------------RTSCFPCGGGLATKHQGATSFQDCETRVQCS 784

  Fly   980 GVH---TRSGDHIRLPVHDDSYAGEATCYWVIMAPANKAIRLHWNSFSLENAVDCIYDYLEIYDS 1041
            ..|   |.:...||.||  .:|..|                     |...|.|.|          
Human   785 PGHFYNTTTHRCIRCPV--GTYQPE---------------------FGKNNCVSC---------- 816

  Fly  1042 LGAQVNDERSKPLAKYCGNSVPEDLLSHSRQLVLKFVSDYSESDGGFDLTYTFEDRAKCGGHIHA 1106
                       |     ||:.                   ::.||..::|..  ...:|||.:..
Human   817 -----------P-----GNTT-------------------TDFDGSTNITQC--KNRRCGGELGD 844

  Fly  1107 SSGELTSPEYPANYSAGLDCDWHLTGTIDHLLEIQVENFELEQSPNCSADYLEVRNGGGTDSPLI 1171
            .:|.:.||.||.||.|..:|.|.:.......:.|.|....|....:| .|||.:|....::|...
Human   845 FTGYIESPNYPGNYPANTECTWTINPPPKRRILIVVPEIFLPIEDDC-GDYLVMRKTSSSNSVTT 908

  Fly  1172 GRFCGR-DIPARIPGFSHEMRLILHTDSAINGRGFRL 1207
            ...|.. :.|......|.::.:...::...:.|||::
Human   909 YETCQTYERPIAFTSRSKKLWIQFKSNEGNSARGFQV 945

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CubnNP_727348.2 EGF_CA 156..190 CDD:238011 12/37 (32%)
EGF_CA 192..233 CDD:238011 18/95 (19%)
EGF_CA 282..322 CDD:214542 12/64 (19%)
EGF_3 328..366 CDD:289699 16/39 (41%)
EGF 430..457 CDD:278437 9/29 (31%)
EGF_CA 469..503 CDD:238011 8/33 (24%)
CUB 509..622 CDD:238001 20/117 (17%)
CUB 627..737 CDD:238001 21/114 (18%)
CUB 744..849 CDD:294042 13/104 (13%)
CUB 853..970 CDD:238001 16/116 (14%)
CUB 978..1094 CDD:238001 19/118 (16%)
CUB 1100..1211 CDD:238001 28/109 (26%)
CUB 1216..1330 CDD:238001
CUB 1446..1549 CDD:238001
CUB 1554..1667 CDD:238001
CUB 1792..1899 CDD:238001
CUB 1910..1998 CDD:294042
CUB 2019..2133 CDD:238001
CUB 2140..2242 CDD:238001
CUB 2263..2379 CDD:238001
CUB 2385..2511 CDD:238001
CUB 2516..2630 CDD:238001
CUB <2833..2892 CDD:294042
CUB 2898..3008 CDD:238001
CUB 3011..3127 CDD:238001
CUB 3130..3241 CDD:238001
CUB 3254..3363 CDD:238001
CUB 3379..3508 CDD:238001
CUB 3531..3601 CDD:294042
CUB 3623..3733 CDD:238001
SCUBE2NP_001354906.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.