DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cubn and tld

DIOPT Version :9

Sequence 1:NP_727348.2 Gene:Cubn / 326235 FlyBaseID:FBgn0052702 Length:3750 Species:Drosophila melanogaster
Sequence 2:NP_524487.2 Gene:tld / 42945 FlyBaseID:FBgn0003719 Length:1067 Species:Drosophila melanogaster


Alignment Length:958 Identity:236/958 - (24%)
Similarity:376/958 - (39%) Gaps:218/958 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   503 ETRFSSCNGMLSAQSGRLRYPPEGTGYEHNAQCAWVIRTNESLVVNVTFNSFDVEDSTECRFDWL 567
            :|.||..:..|..|:.|         :..|..|...:..:.:|..|..:  |.|::...|.|  |
  Fly   156 DTIFSGAHKALFKQAMR---------HWENFTCIKFVERDPNLHANYIY--FTVKNCGCCSF--L 207

  Fly   568 QIN-DGRSAAAQIIGRYCGNHLPHGGNIVSSGNQLYLWFRSDNSTAKEGFDLTWNSMEPQCG--- 628
            ..| :||...:  |||.|                             |.|.:..:.:....|   
  Fly   208 GKNGNGRQPIS--IGRNC-----------------------------EKFGIIIHELGHTIGFHH 241

  Fly   629 --GRLNFETHGTLASPGSPGNYPKNRDCRWQLVAPTTKRIKLTFFSLQLEQHANCNFDYVLIKDS 691
              .|.:.:.|..:    :.||..:.::..:.:::|....:.|..:.|....|        ..|:|
  Fly   242 EHARGDRDKHIVI----NKGNIMRGQEYNFDVLSPEEVDLPLLPYDLNSIMH--------YAKNS 294

  Fly   692 ISGRELAKYCTTGAPAPLLLPTHLAEIHFHSDAEGSDTGFQLHYSVEERVPGCGGVYT------- 749
            .|   .:.|..|..|..:...|||........:.|......|.|    :...||..|.       
  Fly   295 FS---KSPYLDTITPIGIPPGTHLELGQRKRLSRGDIVQANLLY----KCAS
CGRTYQQNSGHIV 352

  Fly   750 ------AKEGTISE---SSTANTEPGGVS--------CEYEIHLAVGEQVVIQFARLEL-DPLDC 796
                  :..|.:||   |..|..:|...|        ||:.|....||:|::...:|.| ...||
  Fly   353 SPHFIYSGNGVLSEFEGSGDAGEDPSAESEFDASLTNCEWRITATNGEKVILHLQQLHLMSSDDC 417

  Fly   797 L-EVLDITDEGG----SILQEKICGSDASRLNPPTFTSEFNRLKIKFYARAGS-----FQLNYRM 851
            . :.|:|.|  |    |.|..:|||:    ::....|::.:|:.:.:..|..:     |:..:.:
  Fly   418 TQDYLEIRD--GYWHKSPLVRRICGN----VSGEVITTQTSRMLLNYVNRNAAKGYRGFKARFEV 476

  Fly   852 AC--DYKLNNEQGTITSPGYPNLTRSDRICTYTISTATNTVISLKRIDFQLTNGESDDDDNDECL 914
            .|  |.||..:| :|.||.||.....|:.|.:.|:...|..::||...|:|       :.:|.|.
  Fly   477 VCGGDLKLTKDQ-SIDSPNYPMDYMPDKECVWRITAPDNHQVALKFQSFEL-------EKHDGCA 533

  Fly   915 TTNLRINDG--LNRKILGPYCG----------KNQPEENFVSETNYLQLHLST----DVD----- 958
            ...:.|.||  .:.:::|.:||          .||....|||:::..:|..|.    |||     
  Fly   534 YDFVEIRDGNHSDSRLIGRFCGDKLPPNIKTRSNQMYIRFVSDSSVQKLGFSAALMLDVDECKFT 598

  Fly   959 ----------SMGR---GFKFEYRALATG---NDKCGGV--HTRSGDHIRLPVHDDSYAGEATCY 1005
                      ::|.   |.:..|...|.|   .|.||||  .|:|...:..|.:.|.|.....|.
  Fly   599 DHGCQHLCINTLGSYQCGCRAGYELQANGKTCEDACGGVVDATKSNGSLYSPSYPDVYPNSKQCV 663

  Fly  1006 WVIMAPANKAIRLHWNSFSLENA----VDCIYDYLEIYDSLGAQVNDERSKPLAKYCGNSVPEDL 1066
            |.::||.|.|:.|:::.|.||..    ..|.||||.||    :::.|.|.|.:..|||:.:|..:
  Fly   664 WEVVAPPNHAVFLNFSHFDLEGTRFHYTKCNYDYLIIY----SKMRDNRLKKIGIYCGHELPPVV 724

  Fly  1067 LSHSRQLVLKFVSDYSESDGGF------DLT---------------------------YTFED-- 1096
            .|....|.|:|.||.:....||      |:.                           ||..:  
  Fly   725 NSEQSILRLEFYSDRTVQRSGFVAKFVIDVDECSMNNGGCQHRCRNTFGSYQCSCRNGYTLAENG 789

  Fly  1097 ----RAKCGGHIHASSGELTSPEYPANYSAGLDCDWHLTGTIDHLLEIQVENFELEQSPNCSADY 1157
                ..:|...|..|.|.|.||.||.:|...:.|.||....:.|.:::...:||:|....|..||
  Fly   790 HNCTETRCKFEITTSYGVLQSPNYPEDYPRNIYCYWHFQTVLGHRIQLTFHDFEVESHQECIYDY 854

  Fly  1158 LEVRNGGGTDSPLIGRFCGRDIPARIPGFSHEMRLILHTDSAINGRGFRLRWRIFAFGCGGSLRS 1222
            :.:.:|...:|..:|.:||...|..:...::||.::|.||:.:..:||:   ..|...|||.||:
  Fly   855 VAIYDGRSENSSTLGIYCGGREPYAVIASTNEMFMVLATDAGLQRKGFK---ATFVSECGGYLRA 916

  Fly  1223 ---NMGAISSPRY-PNSYPNMAHCEWRISLHPGSGISLLIEDLELEGLSNCYYDSVKIYTGIKLP 1283
               :....|.||| ...|....:|:|||...|.|.:.:.....|:|....|.||    |..|...
  Fly   917 TNHSQTFYSHPRYGSRPYKRNMYCDWRIQADPESSVKIRFLHFEIEYSERCDYD----YLEITEE 977

  Fly  1284 NQSPCKVLCKDDDLHNPLIQLENNKGTIV-FDSDASNTFRGFRISYKA 1330
            ..|...:..:....|.|.|.:.|:...:: |.:|.||:.|||.||:.|
  Fly   978 GYSMNTIHGRFCGKHKPPIIISNSDTLLLRFQTDESNSLRGFAISFMA 1025

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CubnNP_727348.2 EGF_CA 156..190 CDD:238011
EGF_CA 192..233 CDD:238011
EGF_CA 282..322 CDD:214542
EGF_3 328..366 CDD:289699
EGF 430..457 CDD:278437
EGF_CA 469..503 CDD:238011 236/958 (25%)
CUB 509..622 CDD:238001 21/113 (19%)
CUB 627..737 CDD:238001 21/114 (18%)
CUB 744..849 CDD:294042 33/139 (24%)
CUB 853..970 CDD:238001 39/152 (26%)
CUB 978..1094 CDD:238001 43/154 (28%)
CUB 1100..1211 CDD:238001 33/110 (30%)
CUB 1216..1330 CDD:238001 37/118 (31%)
CUB 1446..1549 CDD:238001
CUB 1554..1667 CDD:238001
CUB 1792..1899 CDD:238001
CUB 1910..1998 CDD:294042
CUB 2019..2133 CDD:238001
CUB 2140..2242 CDD:238001
CUB 2263..2379 CDD:238001
CUB 2385..2511 CDD:238001
CUB 2516..2630 CDD:238001
CUB <2833..2892 CDD:294042
CUB 2898..3008 CDD:238001
CUB 3011..3127 CDD:238001
CUB 3130..3241 CDD:238001
CUB 3254..3363 CDD:238001
CUB 3379..3508 CDD:238001
CUB 3531..3601 CDD:294042
CUB 3623..3733 CDD:238001
tldNP_524487.2 ZnMc_BMP1_TLD 137..338 CDD:239808 45/244 (18%)
Astacin 144..339 CDD:279708 45/245 (18%)
CUB 388..474 CDD:214483 23/91 (25%)
CUB 478..586 CDD:278839 32/115 (28%)
FXa_inhibition 595..630 CDD:291342 5/34 (15%)
CUB 634..750 CDD:278839 41/119 (34%)
FXa_inhibition 757..792 CDD:291342 2/34 (6%)
CUB 797..906 CDD:278839 33/111 (30%)
CUB 910..1023 CDD:278839 36/116 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444888
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.