Sequence 1: | NP_727348.2 | Gene: | Cubn / 326235 | FlyBaseID: | FBgn0052702 | Length: | 3750 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_667337.1 | Gene: | Mfrp / 259172 | MGIID: | 2385957 | Length: | 584 | Species: | Mus musculus |
Alignment Length: | 269 | Identity: | 80/269 - (29%) |
---|---|---|---|
Similarity: | 113/269 - (42%) | Gaps: | 49/269 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 1439 CMEELRGTFGFFQSPNYPKMYPNNLECYWLITVEQDSAIELTINNIDLEDSPNCTKDALTVSNHK 1503
Fly 1504 NSVEVHERHCGSTTKLVITSSGHRLHVRFISDNSHNGLGFEATYRTV------------------ 1550
Fly 1551 --------------------------KATCGGKLTARNGVIESPNYPLNYPAHSRCEWQVEVSQH 1589
Fly 1590 HQIVFEMADLNLESGYDCNWDYLEAYDLTEDDTEGERLFKVCGDETEDDKLLSSSSNMAVVRFIS 1654
Fly 1655 DDSVSKKGF 1663 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cubn | NP_727348.2 | EGF_CA | 156..190 | CDD:238011 | |
EGF_CA | 192..233 | CDD:238011 | |||
EGF_CA | 282..322 | CDD:214542 | |||
EGF_3 | 328..366 | CDD:289699 | |||
EGF | 430..457 | CDD:278437 | |||
EGF_CA | 469..503 | CDD:238011 | |||
CUB | 509..622 | CDD:238001 | |||
CUB | 627..737 | CDD:238001 | |||
CUB | 744..849 | CDD:294042 | |||
CUB | 853..970 | CDD:238001 | |||
CUB | 978..1094 | CDD:238001 | |||
CUB | 1100..1211 | CDD:238001 | |||
CUB | 1216..1330 | CDD:238001 | |||
CUB | 1446..1549 | CDD:238001 | 36/102 (35%) | ||
CUB | 1554..1667 | CDD:238001 | 40/110 (36%) | ||
CUB | 1792..1899 | CDD:238001 | |||
CUB | 1910..1998 | CDD:294042 | |||
CUB | 2019..2133 | CDD:238001 | |||
CUB | 2140..2242 | CDD:238001 | |||
CUB | 2263..2379 | CDD:238001 | |||
CUB | 2385..2511 | CDD:238001 | |||
CUB | 2516..2630 | CDD:238001 | |||
CUB | <2833..2892 | CDD:294042 | |||
CUB | 2898..3008 | CDD:238001 | |||
CUB | 3011..3127 | CDD:238001 | |||
CUB | 3130..3241 | CDD:238001 | |||
CUB | 3254..3363 | CDD:238001 | |||
CUB | 3379..3508 | CDD:238001 | |||
CUB | 3531..3601 | CDD:294042 | |||
CUB | 3623..3733 | CDD:238001 | |||
Mfrp | NP_667337.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 108..140 | ||
CUB | 150..258 | CDD:238001 | 39/109 (36%) | ||
LDLa | 266..300 | CDD:238060 | 0/33 (0%) | ||
CUB | 307..419 | CDD:238001 | 40/110 (36%) | ||
Fz | 471..573 | CDD:279700 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4292 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |