powered by:
Protein Alignment Tango5 and CG16957
DIOPT Version :9
Sequence 1: | NP_001162716.1 |
Gene: | Tango5 / 326232 |
FlyBaseID: | FBgn0052675 |
Length: | 530 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001285897.1 |
Gene: | CG16957 / 34755 |
FlyBaseID: | FBgn0032519 |
Length: | 192 |
Species: | Drosophila melanogaster |
Alignment Length: | 62 |
Identity: | 16/62 - (25%) |
Similarity: | 27/62 - (43%) |
Gaps: | 8/62 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 274 NIWSIMSKVRLEAFLWGAGTALGELPPYFMAKAARLSGYDPEDAEELAEFEAL-NAKRHQKN 334
||:.:...|. .:|.. |..|.|.....:|:....|||.::..:|:.| :..|:|.|
Fly 97 NIYDVSRSVH----YYGRN---GVNPNYAGRDISRILINSPEDLKDSEDFDDLSDLSRNQMN 151
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Tango5 | NP_001162716.1 |
SNARE_assoc |
<346..395 |
CDD:294297 |
|
CG16957 | NP_001285897.1 |
Cyt-b5 |
72..170 |
CDD:278597 |
16/62 (26%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45452925 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR10281 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.030 |
|
Return to query results.
Submit another query.