DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango5 and CG16957

DIOPT Version :9

Sequence 1:NP_001162716.1 Gene:Tango5 / 326232 FlyBaseID:FBgn0052675 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001285897.1 Gene:CG16957 / 34755 FlyBaseID:FBgn0032519 Length:192 Species:Drosophila melanogaster


Alignment Length:62 Identity:16/62 - (25%)
Similarity:27/62 - (43%) Gaps:8/62 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 NIWSIMSKVRLEAFLWGAGTALGELPPYFMAKAARLSGYDPEDAEELAEFEAL-NAKRHQKN 334
            ||:.:...|.    .:|..   |..|.|.....:|:....|||.::..:|:.| :..|:|.|
  Fly    97 NIYDVSRSVH----YYGRN---GVNPNYAGRDISRILINSPEDLKDSEDFDDLSDLSRNQMN 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango5NP_001162716.1 SNARE_assoc <346..395 CDD:294297
CG16957NP_001285897.1 Cyt-b5 72..170 CDD:278597 16/62 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452925
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10281
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.