DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango5 and t-cup

DIOPT Version :9

Sequence 1:NP_001162716.1 Gene:Tango5 / 326232 FlyBaseID:FBgn0052675 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_723757.1 Gene:t-cup / 318986 FlyBaseID:FBgn0051858 Length:216 Species:Drosophila melanogaster


Alignment Length:175 Identity:35/175 - (20%)
Similarity:61/175 - (34%) Gaps:59/175 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 TALGELPPYFMAKAARLSGYDPEDAEELAEFEALNAKRHQKNLSMMDRGKLF-MERVVERVGFFG 356
            |.|.:||| ......:|.|:|              ..|....:.:..|||:: :....|..|..|
  Fly    49 TNLPDLPP-IKLNLDQLLGFD--------------GTRSDGRILVALRGKIYDVSSDFEEFGLTG 98

  Fly   357 ILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAVIKMHIQKI-FV-----IIAFNETLIE 415
            .|:         .:||....::|             |:::..|..:| :|     |:..|.:.:.
  Fly    99 TLS---------HVAGRDFTNYL-------------KSIMDTHNSEINYVDRWESILETNYSCVG 141

  Fly   416 RAVDLLATLPVLG----HKLQ----------EPFKSFLKNQKQRL 446
            ..:|.... |::|    |.:.          ||.|:..|:.|..|
  Fly   142 EVIDEQGN-PLMGKIENHDVDVMEETEEDMIEPIKANEKSMKSVL 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango5NP_001162716.1 SNARE_assoc <346..395 CDD:294297 8/48 (17%)
t-cupNP_723757.1 Cyt-b5 72..143 CDD:278597 16/92 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10281
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.