DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9Fa and Rab19

DIOPT Version :9

Sequence 1:NP_727471.1 Gene:Rab9Fa / 326230 FlyBaseID:FBgn0052671 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001261575.1 Gene:Rab19 / 38930 FlyBaseID:FBgn0015793 Length:219 Species:Drosophila melanogaster


Alignment Length:186 Identity:68/186 - (36%)
Similarity:103/186 - (55%) Gaps:27/186 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YDNPFKIIILGDSGVGKTCLLMRFSDNQFTTRHRSTVGLD--RRECSVEFADWRMGRM--LQVWD 64
            :|..|||:::||.|.||||::.||....:..||.:|:|:|  .:..:||      |:.  ||:||
  Fly    18 FDFLFKIVLIGDCGTGKTCIVDRFKTGNYIERHGNTIGVDFSMKTIAVE------GKQIKLQIWD 76

  Fly    65 TSDDERFKLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVTVLLVGNKSDDPNH 129
            |:..|||:.:..:..|||:|:|:|||||...||.|:..|::|:||.....|.::|||||.|....
  Fly    77 TAGQERFRTITQSYYRSANGVLIVYDITKRSSFSNLQKWIEEVRRYTASNVLIILVGNKCDLEEQ 141

  Fly   130 RQVSMAQGFNYAHRQSIC--------FEEVSAKSGRNVYDIFSSLAMDIYTYRRVH 177
            |:|      ::...:.:|        ..|.|||...||.|.|..||.::   :|.|
  Fly   142 REV------DFEEARQMCQYIPEILFVMETSAKENMNVEDAFRCLANEL---KRQH 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9FaNP_727471.1 RAB 8..171 CDD:197555 65/174 (37%)
Rab 8..167 CDD:206640 63/170 (37%)
Rab19NP_001261575.1 Rab19 19..184 CDD:133267 66/176 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454141
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.