DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9Fa and Rab32

DIOPT Version :9

Sequence 1:NP_727471.1 Gene:Rab9Fa / 326230 FlyBaseID:FBgn0052671 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_525109.1 Gene:Rab32 / 35940 FlyBaseID:FBgn0002567 Length:686 Species:Drosophila melanogaster


Alignment Length:171 Identity:43/171 - (25%)
Similarity:83/171 - (48%) Gaps:11/171 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FKIIILGDSGVGKTCLLMRFSDNQFTTRHRSTVGLDRRECSVEFADWRMGRM--LQVWDTSDDER 70
            :||:::|:.|.|||..:.|:....|:..:|:|:|:|   .:::...|....:  ||:||.:..||
  Fly   484 YKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVD---FALKVLQWDANTIVRLQLWDIAGQER 545

  Fly    71 FKLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEI--RRLCPD--KVTVLLVGNKSDDPNHRQ 131
            |..:.....:.|.|..:|:|:|.|.:|..:..|.:::  :...||  .:..:|:.||.|......
  Fly   546 FGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKCDQEKQGI 610

  Fly   132 VSMAQGFN-YAHRQSIC-FEEVSAKSGRNVYDIFSSLAMDI 170
            ::..:..: |....... :.|.|||...|:.:...:|...|
  Fly   611 ITQPEKMDEYVRENGFAGWFETSAKENINIDEAARALVNKI 651

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9FaNP_727471.1 RAB 8..171 CDD:197555 43/171 (25%)
Rab 8..167 CDD:206640 41/166 (25%)
Rab32NP_525109.1 Rab32_Rab38 484..686 CDD:206692 43/171 (25%)
RAB 484..652 CDD:197555 43/171 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454375
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.