DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp2 and ACTL6A

DIOPT Version :9

Sequence 1:NP_001259621.1 Gene:Arp2 / 32623 FlyBaseID:FBgn0011742 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_004292.1 Gene:ACTL6A / 86 HGNCID:24124 Length:429 Species:Homo sapiens


Alignment Length:455 Identity:129/455 - (28%)
Similarity:202/455 - (44%) Gaps:112/455 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKD----LHVDDLMVGDEASQ- 68
            :|.|.|:..|:.||||.:.|...||:.:|  |:        :|..|    :.:|    ||:..| 
Human    14 LVFDIGSYTVRAGYAGEDCPKVDFPTAIG--MV--------VERDDGSTLMEID----GDKGKQG 64

  Fly    69 -------------LRSLLEVSYPMENGVVRNWDDMCHVWDYTFGPKKMDI--DPTNTKILLTEPP 118
                         .|..:|...|::||:|.:||....:.|:|:   ||.:  :.:...:|::|.|
Human    65 GPTYYIDTNALRVPRENMEAISPLKNGMVEDWDSFQAILDHTY---KMHVKSEASLHPVLMSEAP 126

  Fly   119 MNPTKNREKMIEVMFEKYGFDSAYIAIQAVLTLYAQGLISGVVIDSGDGVTHICPVYEEFALPHL 183
            .|....|||:.|:|||.|...:.::...||||.:|.|..:|:::|||...|...||::.:.|...
Human   127 WNTRAKREKLTELMFEHYNIPAFFLCKTAVLTAFANGRSTGLILDSGATHTTAIPVHDGYVLQQG 191

  Fly   184 TRRLDIAGRDITRYLIKLL------LLRGYAFNHSADFETVR-------IMKEKL---------- 225
            ..:..:||..||....:|.      |:..|..   |..|.||       ..||||          
Human   192 IVKSPLAGDFITMQCRELFQEMNIELVPPYMI---ASKEAVREGSPANWKRKEKLPQVTRSWHNY 253

  Fly   226 ---CYI-------------GYDIEMEQRLALETTVLVESYTLPDGRVIKVGGERFEAPEALFQPH 274
               |.|             .||   ||..|...||   .|..|:|.....|.||.:.||.||.|.
Human   254 MCNCVIQDFQASVLQVSDSTYD---EQVAAQMPTV---HYEFPNGYNCDFGAERLKIPEGLFDPS 312

  Fly   275 LINVEG------PGIAELAFNTIQAADIDIRPELYKHIVLSGGSTMYPGLPSRLEREIKQ----- 328
              ||:|      .|::.:...::...||||||.||..::::||:|:......||.||:.|     
Human   313 --NVKGLSGNTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGNTLIQSFTDRLNRELSQKTPPS 375

  Fly   329 LYLERVLKNDTEKLAKFKIRIEDPPRRKDMVFIGGAVLAEVTKDRDGFWMSKQEYQEQGLKVLQK 393
            :.|:.:..|.|.:             |:...:|||::||.:...:. .|:|||||:|.|.:.:::
Human   376 MRLKLIANNTTVE-------------RRFSSWIGGSILASLGTFQQ-MWISKQEYEEGGKQCVER 426

  Fly   394  393
            Human   427  426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp2NP_001259621.1 ACTIN 6..393 CDD:214592 129/453 (28%)
ACTL6ANP_004292.1 Actin 11..429 CDD:394979 129/455 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.