DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp2 and ARP9

DIOPT Version :9

Sequence 1:NP_001259621.1 Gene:Arp2 / 32623 FlyBaseID:FBgn0011742 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_013747.1 Gene:ARP9 / 855049 SGDID:S000004636 Length:467 Species:Saccharomyces cerevisiae


Alignment Length:346 Identity:73/346 - (21%)
Similarity:133/346 - (38%) Gaps:93/346 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 KYGFDSAYI--AIQAVLTLYAQ----GLISGVVIDSGDGVTHICPVYEEFALPHLTRRLDIAGRD 193
            :|.|:|..|  .||...:|.|.    .|.:..:||.|...|.|.|:.:...|.||...:.:.|:.
Yeast   129 QYVFESLEINNLIQLPASLAATYSMISLQNCCIIDVGTHHTDIIPIVDYAQLDHLVSSIPMGGQS 193

  Fly   194 ITRYLIKLL-------------------------LLRGYAF-NHSADFETVRIMKEKLCYIGYDI 232
            |...|.|||                         .|..:.| |.:.|.:...:...::...|.|.
Yeast   194 INDSLKKLLPQWDDDQIESLKKSPIFEVLSDDAKKLSSFDFGNENEDEDEGTLNVAEIITSGRDT 258

  Fly   233 E--MEQRLALETTVLVESYTL-------PDGRVIKVGGERFEAPEALFQPHLINVEGPGIAELAF 288
            .  :|:|...:....|::..|       ..|..||||.:||:....|.: ::.|..|     |..
Yeast   259 REVLEERERGQKVKNVKNSDLEFNTFWDEKGNEIKVGKQRFQGCNNLIK-NISNRVG-----LTL 317

  Fly   289 NTIQAADIDIRPELYKHIVLSGGSTMYPGLPSRL---------------EREIKQLYLERVLKND 338
            :.|.  ||:....::::|::.||:|...|....|               |:..::...:.||...
Yeast   318 DNID--DINKAKAVWENIIIVGGTTSISGFKEALLGQLLKDHLIIEPEEEKSKREEEAKSVLPAA 380

  Fly   339 TEKLAKFKIR----------IEDP------------PRRK-----DMVFIGGAVLAE--VTKDRD 374
            |:|.:||...          ::.|            |..|     :::|:|..::::  .|..:|
Yeast   381 TKKKSKFMTNSTAFVPTIEYVQCPTVIKLAKYPDYFPEWKKSGYSEIIFLGAQIVSKQIFTHPKD 445

  Fly   375 GFWMSKQEYQEQGLKVLQKLQ 395
            .|::::::|..:|...|..:|
Yeast   446 TFYITREKYNMKGPAALWDVQ 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp2NP_001259621.1 ACTIN 6..393 CDD:214592 72/342 (21%)
ARP9NP_013747.1 COG5277 1..467 CDD:227602 73/346 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.