DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp2 and ACT1

DIOPT Version :9

Sequence 1:NP_001259621.1 Gene:Arp2 / 32623 FlyBaseID:FBgn0011742 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_116614.1 Gene:ACT1 / 850504 SGDID:S000001855 Length:375 Species:Saccharomyces cerevisiae


Alignment Length:391 Identity:177/391 - (45%)
Similarity:259/391 - (66%) Gaps:21/391 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDSKGRNVIVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKDLHVDDLMVGDE 65
            |||:.. .:|.|||:|..|.|:||.:.|..:|||:||||..:.: .:|      :...|..||||
Yeast     1 MDSEVA-ALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGI-MVG------MGQKDSYVGDE 57

  Fly    66 ASQLRSLLEVSYPMENGVVRNWDDMCHVWDYTFGPKKMDIDPTNTKILLTEPPMNPTKNREKMIE 130
            |...|.:|.:.||:|:|:|.|||||..:|.:|| ..::.:.|....:||||.||||..|||||.:
Yeast    58 AQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEAPMNPKSNREKMTQ 121

  Fly   131 VMFEKYGFDSAYIAIQAVLTLYAQGLISGVVIDSGDGVTHICPVYEEFALPHLTRRLDIAGRDIT 195
            :|||.:...:.|::|||||:||:.|..:|:|:||||||||:.|:|..|:|||...|:|:||||:|
Yeast   122 IMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLT 186

  Fly   196 RYLIKLLLLRGYAFNHSADFETVRIMKEKLCYIGYDIEMEQRLALETTVLVESYTLPDGRVIKVG 260
            .||:|:|..|||:|:.:|:.|.||.:||||||:..|.|.|.:.|.:::.:.:||.||||:||.:|
Yeast   187 DYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITIG 251

  Fly   261 GERFEAPEALFQPHLINVEGPGIAELAFNTIQAADIDIRPELYKHIVLSGGSTMYPGLPSRLERE 325
            .|||.||||||.|.::.:|..||.:..:|:|...|:|:|.|||.:||:|||:||:||:..|:::|
Yeast   252 NERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKE 316

  Fly   326 IKQLYLERVLKNDTEKLAKFKIRIEDPPRRKDMVFIGGAVLAEVTKDRDGFWMSKQEYQEQGLKV 390
            |..|           ..:..|::|..||.||..|:|||::||.:|..:. .|:|||||.|.|..:
Yeast   317 ITAL-----------APSSMKVKIIAPPERKYSVWIGGSILASLTTFQQ-MWISKQEYDESGPSI 369

  Fly   391 L 391
            :
Yeast   370 V 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp2NP_001259621.1 ACTIN 6..393 CDD:214592 174/386 (45%)
ACT1NP_116614.1 NBD_sugar-kinase_HSP70_actin 1..375 CDD:418402 177/391 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.