DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp2 and ACTL8

DIOPT Version :9

Sequence 1:NP_001259621.1 Gene:Arp2 / 32623 FlyBaseID:FBgn0011742 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_110439.2 Gene:ACTL8 / 81569 HGNCID:24018 Length:366 Species:Homo sapiens


Alignment Length:403 Identity:118/403 - (29%)
Similarity:201/403 - (49%) Gaps:67/403 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RNVIVCDNGTGFVKCGYAGSNFPTHIFPSMV---------GRPMIRAVNKIGDIEVKDLHVDDLM 61
            |.||: |:|:||:|.|.||.|.|..:||::|         |....|....:| |::  .|.|.. 
Human     4 RTVII-DHGSGFLKAGTAGWNEPQMVFPNIVNYLPCKENPGPSYARRRVSLG-IDI--CHPDTF- 63

  Fly    62 VGDEASQLRSLLEVSYPMENGVVRNWDDMCHVWDYTF--GPKKMDIDPTNTKILLTEPPMNPTKN 124
                          |||:|.|.:.||:.:.::|.:..  ..::.::.|    :::||.|:....:
Human    64 --------------SYPIERGRILNWEGVQYLWSFVLENHRREQEVPP----VIITETPLREPAD 110

  Fly   125 REKMIEVMFEKYGFDSAYIAIQAVLTLYAQGLISGVVIDSGDGVTHICPVYEEFALPHLTRRLDI 189
            |:||:|::||.....|..:|.|..::|||.||::|||:|||.|:|.:.|.::...||...:.|:.
Human   111 RKKMLEILFELLHVPSVLLADQLQMSLYASGLLTGVVVDSGYGLTRVQPFHQGRPLPASGKTLEF 175

  Fly   190 AGRDITRYLIKLLLLRGYAFNHSAD------FETVRIMKEKLCYI------GYDIEMEQRLALET 242
            ||:|::.||:|.|      |....|      .|||.:.:...||:      ..|....|:.||:.
Human   176 AGQDLSAYLLKSL------FKEDCDRRCLFQLETVAVTQMNKCYVPQNLGEALDFRERQQSALDE 234

  Fly   243 TVLVESYTLPDGRVIKVGGERFEAPEALFQPHLINVEGPGIAELAFNTIQAADIDIRPELYKHIV 307
            :   .:|.||||..:::...:..|||..|.|.:....||.|......::::.:|.:||.|..|::
Human   235 S---NTYQLPDGSRVELTPMQRVAPEMFFSPQVFEQPGPSIPRAIVESVESCEISLRPLLVSHVM 296

  Fly   308 LSGGSTMYPGLPSRLEREIKQLYLERVLKNDTEKLAKFKIRIEDPPRRKDMVFIGGAVLAEVTKD 372
            ..||:|:|||...||.||:.           .:.::..|..:.:...|...|::|.:|:|.::..
Human   297 ACGGNTLYPGFTKRLFRELM-----------GDHVSSTKATVWEGSNRNFSVWLGASVVAHLSTY 350

  Fly   373 RDGFWMSKQEYQE 385
            :.. |||::||.|
Human   351 QSE-WMSREEYGE 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp2NP_001259621.1 ACTIN 6..393 CDD:214592 118/403 (29%)
ACTL8NP_110439.2 ACTIN 4..363 CDD:214592 118/403 (29%)
NBD_sugar-kinase_HSP70_actin 7..362 CDD:302596 115/398 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.