DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp2 and Actr3

DIOPT Version :9

Sequence 1:NP_001259621.1 Gene:Arp2 / 32623 FlyBaseID:FBgn0011742 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001192314.1 Gene:Actr3 / 74117 MGIID:1921367 Length:418 Species:Mus musculus


Alignment Length:405 Identity:138/405 - (34%)
Similarity:208/405 - (51%) Gaps:36/405 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKDL--HVDDL--MVGDEASQLR 70
            |.|.|||:.|.||||:..|..|.||.:.   |:...|:||...:.:  .||||  .:||||.: :
Mouse     9 VVDCGTGYTKLGYAGNTEPQFIIPSCIA---IKESAKVGDQAQRRVMKGVDDLDFFIGDEAIE-K 69

  Fly    71 SLLEVSYPMENGVVRNWDDMCHVWDYTFGPKKMDIDPTNTKILLTEPPMNPTKNREKMIEVMFEK 135
            ......:|:.:|:|.:||.|....:.... |.:..:|.:...||||||:|..:|||...|:|||.
Mouse    70 PTYATKWPIRHGIVEDWDLMERFMEQVIF-KYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFES 133

  Fly   136 YGFDSAYIAIQAVLTLYA--------QGLISGVVIDSGDGVTHICPVYEEFALPHLTRRLDIAGR 192
            :.....|||:||||.|.|        :..::|.||||||||||:.||.|.:.:....:.:.||||
Mouse   134 FNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGR 198

  Fly   193 DITRYLIKLLLLRGYAFNHSADFETVRIMKEKLCYIGYDIEME-QRLALETTVLVESYTLPDG-- 254
            |||.::.:||..|..........||.:.:||:..|:..|:..| .:...:.:..::.||..:.  
Mouse   199 DITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGVNAIS 263

  Fly   255 ---RVIKVGGERFEAPEALFQPHLINVE-GPGIAELAFNTIQAADIDIRPELYKHIVLSGGSTMY 315
               ..|.||.|||..||..|.|...|.: ...|:|:....||...||:|..|||:|||||||||:
Mouse   264 KKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMF 328

  Fly   316 PGLPSRLEREIK-----QLYLERVLKNDTEKLAKFKIRIEDPPRRKDMVFIGGAVLAEVTKDRDG 375
            .....||:|::|     :|.|...|.....|.....:::.....::..|:.||::||...:    
Mouse   329 RDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPE---- 389

  Fly   376 FWM---SKQEYQEQG 387
            |:.   :|::|:|.|
Mouse   390 FYQVCHTKKDYEEIG 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp2NP_001259621.1 ACTIN 6..393 CDD:214592 138/405 (34%)
Actr3NP_001192314.1 PTZ00280 2..417 CDD:240343 138/405 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.