DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp2 and Actl10

DIOPT Version :9

Sequence 1:NP_001259621.1 Gene:Arp2 / 32623 FlyBaseID:FBgn0011742 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001165111.1 Gene:Actl10 / 70362 MGIID:1917612 Length:346 Species:Mus musculus


Alignment Length:347 Identity:97/347 - (27%)
Similarity:172/347 - (49%) Gaps:48/347 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LMVGDEASQLRSLLEVSYPMENGVVRNWDDMCHVWDYTF--GPKKMDIDPTNTKILLTEPPMNPT 122
            ::.|....:|...:..::|:::|||.:||.:..:|:...  |   :.:.|....:|:::.|..|.
Mouse    20 VLPGAPGCELAGGVARAHPIKHGVVVDWDALEGLWERLMVGG---LQVHPEQWPVLVSDSPSAPP 81

  Fly   123 KNREKMIEVMFEKYGFDSAYIAIQAVLTLYAQGLISGVVIDSGDGVTHICPVYEEFALPHLTRRL 187
            |.|||:.|::||.....:.::|..|:|.|.:.|..||:.:::|.||.|..|:|...:....|.||
Mouse    82 KGREKVAELLFEALTVPACHMANTALLALCSIGAFSGLAVEAGAGVCHATPIYAGHSWHKATFRL 146

  Fly   188 DIAGRDITRYLIKLLL-------LRGYAFNHSADFETVRIMKEKLCYIGYDIE-------MEQRL 238
            ::||..::||...||:       |:|.:      .:||..:|::.||:..|.:       ..||.
Mouse   147 NVAGSTLSRYFRDLLVAACPDLQLQGLS------RKTVTQLKKRCCYVSLDFQGDICDPARHQRA 205

  Fly   239 ALETTVLVESYTLPDGRVIKVGGERFEAPEALFQPHLINVEGPGIAELAFNTIQAADIDIRPELY 303
            .         :.|.:|..:::|.|||..||.:|||.|:....||:..|||..:|.....:|..|.
Mouse   206 C---------FCLGNGCYVRLGSERFRCPEPIFQPSLLGHPEPGLPTLAFQALQKIPTTLRTRLA 261

  Fly   304 KHIVLSGGSTMYPGLPSRLEREIKQLYLERVLKNDTEKLAKFKIRIEDPPRRKDMVFIGGAVLAE 368
            ..:||:||||::||...|:..|::    .:..::....|....:.   .|.|...|:.||:::|.
Mouse   262 NTVVLAGGSTLFPGFVERMNLELE----AQCRRHGYPALQPCLVA---HPGRDTAVWTGGSMMAS 319

  Fly   369 VTKDRDGF---WMSKQEYQEQG 387
            :    :.|   ||::..|||.|
Mouse   320 L----NSFQCRWMTRAMYQEHG 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp2NP_001259621.1 ACTIN 6..393 CDD:214592 97/347 (28%)
Actl10NP_001165111.1 NBD_sugar-kinase_HSP70_actin 37..341 CDD:302596 95/330 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.