DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp2 and ACTR3C

DIOPT Version :9

Sequence 1:NP_001259621.1 Gene:Arp2 / 32623 FlyBaseID:FBgn0011742 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_016868037.1 Gene:ACTR3C / 653857 HGNCID:37282 Length:280 Species:Homo sapiens


Alignment Length:280 Identity:85/280 - (30%)
Similarity:122/280 - (43%) Gaps:52/280 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 MFEKYGFDSAYIAIQAVLTLYA--------QGLISGVVIDSGDGVTHICPVYEEFALPHLTRRLD 188
            |||.:.....|||:||||.|.|        :..::|:||||||||||:.||.|.:.:....:.:.
Human     1 MFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPVAEGYVIGSCIKHIP 65

  Fly   189 IAGRDITRYLIKLLLLRGYAFNHSADFETVRIMKEKLCYIGYDIEME-QRLALETTVLVESYTLP 252
            |||||||.::.:||..|..........||.:.:|||.|||..||..| .:..::....::.||..
Human    66 IAGRDITYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVKEFAKYDVDPQKWIKQYTGI 130

  Fly   253 DG-----RVIKVGGERFEAPEALFQPHLINVEG-PGIAELAFNTIQAADIDIRPELYKHIVLSGG 311
            :.     .||.||.|||..||..|.|...|.:. ..|:::....||...||:|..|||.:.:   
Human   131 NAINQKKFVIDVGYERFLGPEIFFHPEFANPDSMESISDVVDEVIQNCPIDVRRPLYKVLGV--- 192

  Fly   312 STMYPGLPSRLEREIKQLYLERVLKNDTEKLAKFKIRIEDPPRRKDMVFIGGAVLAEVTKDRDGF 376
                  ||.|        |.:..::..:.........:...|.|     .||             
Human   193 ------LPGR--------YRDHPMRYGSGSWQNLLCHLPTIPGR-----FGG------------- 225

  Fly   377 WMSKQEYQEQGLKVLQKLQK 396
            |...||.  .||::|..|.:
Human   226 WSPAQEL--SGLRILPPLHR 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp2NP_001259621.1 ACTIN 6..393 CDD:214592 84/275 (31%)
ACTR3CXP_016868037.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.