DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp2 and ACTR10

DIOPT Version :9

Sequence 1:NP_001259621.1 Gene:Arp2 / 32623 FlyBaseID:FBgn0011742 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_011535262.1 Gene:ACTR10 / 55860 HGNCID:17372 Length:424 Species:Homo sapiens


Alignment Length:433 Identity:92/433 - (21%)
Similarity:179/433 - (41%) Gaps:107/433 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RNVIVCDNGTGFVKCGYAGSNFPTHIFPSMV---GRPM-IRAVNKIGDIEVKDLHVDDLMVGDEA 66
            :..:|.|.|..|.|||:||...|..|.||::   |.|. :|.|..  :|..::|:          
Human    13 KTAVVIDLGEAFTKCGFAGETGPRCIIPSVIKRAGMPKPVRVVQY--NINTEELY---------- 65

  Fly    67 SQLRSLLEVSYPMENGVVRNWDDMCHVWDYTFGPKKMDIDPTNTKILLTEPPMNPTKNREKMIEV 131
            |.|:..:.:.|                    |  :.:.::|.:.::::.|..:.|:..||.:..|
Human    66 SYLKEFIHILY--------------------F--RHLLVNPRDRRVVIIESVLCPSHFRETLTRV 108

  Fly   132 MFEKYGFDSAYIAIQAVLTLYAQGLISGVVIDSGDGVTHICPVYEEFALPHLTRRLDIAGRDITR 196
            :|:.:...|..:|...::.|...|:.|.:|:|.|...:.:.|:||...:.:....|.:.|:.:.:
Human   109 LFKYFEVPSVLLAPSHLMALLTLGINSAMVLDCGYRESLVLPIYEGIPVLNCWGALPLGGKALHK 173

  Fly   197 YLIKLLL-----------------------------LRGYAFNHSADFETVRIMKEKLCYIGYDI 232
            .|...||                             ::|..|          .:|.:.|::.   
Human   174 ELETQLLEQCTVDTSVAKEQSLPSVMGSVPEGVLEDIKGLLF----------FLKARTCFVS--- 225

  Fly   233 EMEQRLALETTVL-VE------------SYTLPDGRVIKV-GGERFEAPEALFQPHLINVEGPGI 283
            ::::.|.::.... ::            .|.|...:::.: |..|....|.||:.   :.|...:
Human   226 DLKRGLKIQAAKFNIDGNNERPSPPPNVDYPLDGEKILHILGSIRDSVVEILFEQ---DNEEQSV 287

  Fly   284 AELAFNTIQAADIDIRPELYKHIVLSGGSTMYPGLPSRLEREIKQLYLERVLKNDTEKLAKFKIR 348
            |.|..:::....||.|.:|.:::|:.||::|.||...||..||:.|..:...|   :.|.....|
Human   288 ATLILDSLIQCPIDTRKQLAENLVVIGGTSMLPGFLHRLLAEIRYLVEKPKYK---KALGTKTFR 349

  Fly   349 IEDPPRRKDMV-FIGGAV---LAEVTKDRDGFWMSKQEYQEQG 387
            |..||.:.:.| ::|||:   |.::...|.   :||:.|.:.|
Human   350 IHTPPAKANCVAWLGGAIFGALQDILGSRS---VSKEYYNQTG 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp2NP_001259621.1 ACTIN 6..393 CDD:214592 92/433 (21%)
ACTR10XP_011535262.1 NBD_sugar-kinase_HSP70_actin 12..389 CDD:302596 91/431 (21%)
Actin 14..395 CDD:278451 92/432 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.