DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp2 and POTEG

DIOPT Version :9

Sequence 1:NP_001259621.1 Gene:Arp2 / 32623 FlyBaseID:FBgn0011742 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001005356.1 Gene:POTEG / 404785 HGNCID:33896 Length:508 Species:Homo sapiens


Alignment Length:424 Identity:92/424 - (21%)
Similarity:143/424 - (33%) Gaps:146/424 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CDNGTGFVKCG----YAGSNFPTHIFPSMVGRPMIRA--VNKI------GDIEVKDLHV--DDLM 61
            |..|:|..|.|    |..|.|       |..|..:|.  ::|:      |.:..|||.|  .|..
Human   108 CCRGSGKSKVGPWGDYDDSAF-------MEPRYHVRREDLDKLHRAAWWGKVPRKDLIVMLKDTD 165

  Fly    62 VGDEASQLRSLLEVSYPMENGVVRN--WDDMCHVWDYTFGPKKMDIDPTNTKILLTEPPMNPTKN 124
            :..:..|.|:.|.::....|..|..  .|..|          :::|.....:..||:    ..:.
Human   166 MNKKDKQKRTALHLASANGNSEVVKLLLDRRC----------QLNILDNKKRTALTK----AVQC 216

  Fly   125 REKMIEVMF----------EKYGFDSAYIAIQAVLTLYAQG-LISGVVIDSGD--GVTH-ICPVY 175
            ||....:|.          ::||..:.:.||.....|.|:. |:.|..|:|.:  |:|. :..|:
Human   217 REDECALMLLEHGTDPNIPDEYGNTALHYAIYNEDKLMAKALLLYGADIESKNKHGLTPLLLGVH 281

  Fly   176 E--EFALPHLTRR------LDIAGRDI--------TRYLIKLLL---------------LRGYAF 209
            |  :..:..|.::      ||..||..        :..::.|||               .|.||.
Human   282 EQKQQVVKFLIKKKANLNALDRYGRTALILAVCCGSASIVSLLLEQNIDVSSQDLSGQTAREYAV 346

  Fly   210 --NHSADFETVRIMKEK--LCYIGYDIEMEQRLALETTVLVESYTLPDGRVIKVGGERFEAPEAL 270
              :|:...:.:...|||  |.....:...||.|.|  |...||..|.        |.....||.:
Human   347 SSHHNVICQLLSDYKEKQMLKVSSENSNPEQDLKL--TSEEESQRLK--------GSENSQPEEM 401

  Fly   271 FQPHLINVEGPGIAELAFNTIQAADIDIRPELYKHIVLSGGSTMYPGLPSRL------------- 322
            .|...||..|              |..:..|:.||     ||| :.|.|..|             
Human   402 SQEPEINKGG--------------DRKVEEEMKKH-----GST-HMGFPENLPNGATADNGDDGL 446

  Fly   323 ---------------EREIKQLYLERVLKNDTEK 341
                           :.|.:|.:.:.  :|||:|
Human   447 IPPRKSRTPESQQFPDTENEQYHSDE--QNDTQK 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp2NP_001259621.1 ACTIN 6..393 CDD:214592 92/424 (22%)
POTEGNP_001005356.1 Ank_4 143..193 CDD:290365 11/49 (22%)
ANK 167..292 CDD:238125 27/138 (20%)
ANK 1 172..201 7/38 (18%)
ANK repeat 174..203 CDD:293786 7/38 (18%)
Ank_2 177..269 CDD:289560 21/105 (20%)
ANK repeat 205..236 CDD:293786 5/34 (15%)
ANK 2 205..234 5/32 (16%)
ANK 233..357 CDD:238125 26/123 (21%)
ANK repeat 238..269 CDD:293786 10/30 (33%)
ANK 3 238..267 9/28 (32%)
Ank_2 243..335 CDD:289560 20/91 (22%)
ANK repeat 271..302 CDD:293786 5/30 (17%)
ANK 4 271..300 5/28 (18%)
ANK repeat 304..335 CDD:293786 5/30 (17%)
ANK 5 304..333 5/28 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 367..488 31/144 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.