Sequence 1: | NP_001259621.1 | Gene: | Arp2 / 32623 | FlyBaseID: | FBgn0011742 | Length: | 399 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_778146.2 | Gene: | POTED / 317754 | HGNCID: | 23822 | Length: | 584 | Species: | Homo sapiens |
Alignment Length: | 224 | Identity: | 49/224 - (21%) |
---|---|---|---|
Similarity: | 81/224 - (36%) | Gaps: | 59/224 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 104 DIDPTNTKILLTEPPMNPTKNREKMIEVMFEKYGFDSAYIAIQAVLTLYAQ-GLISGVVIDSGDG 167
Fly 168 VTHICPVYEEFALPHLTRRLDIAGRDITRYLIKLLLLRGYAF--NHSADFETVRIMKEK--LCYI 228
Fly 229 GYDIEMEQRLALETTVLVESYTLPDGRVIKVGGERFEAPEALFQPHLINVEGPGIAELAFNTIQA 293
Fly 294 ADIDIRPELYKHIVLSGGSTMYPGLPSRL 322 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Arp2 | NP_001259621.1 | ACTIN | 6..393 | CDD:214592 | 49/224 (22%) |
POTED | NP_778146.2 | Ank_4 | 143..193 | CDD:290365 | |
ANK | 167..292 | CDD:238125 | 6/28 (21%) | ||
ANK 1 | 172..201 | ||||
ANK repeat | 174..203 | CDD:293786 | |||
Ank_2 | 177..269 | CDD:289560 | 2/4 (50%) | ||
ANK repeat | 205..236 | CDD:293786 | |||
ANK 2 | 205..234 | ||||
ANK | 233..357 | CDD:238125 | 24/116 (21%) | ||
ANK repeat | 238..269 | CDD:293786 | 2/4 (50%) | ||
ANK 3 | 238..267 | 2/2 (100%) | |||
Ank_2 | 243..335 | CDD:289560 | 18/89 (20%) | ||
ANK repeat | 271..302 | CDD:293786 | 5/37 (14%) | ||
ANK 4 | 271..300 | 4/35 (11%) | |||
ANK repeat | 304..335 | CDD:293786 | 8/41 (20%) | ||
ANK 5 | 304..333 | 8/39 (21%) | |||
ANK 6 | 337..366 | 8/33 (24%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 369..502 | 21/95 (22%) | |||
SH3_and_anchor | <440..556 | CDD:275056 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5277 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |