DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp2 and Actrt2

DIOPT Version :9

Sequence 1:NP_001259621.1 Gene:Arp2 / 32623 FlyBaseID:FBgn0011742 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001013959.1 Gene:Actrt2 / 298671 RGDID:1359657 Length:377 Species:Rattus norvegicus


Alignment Length:385 Identity:143/385 - (37%)
Similarity:227/385 - (58%) Gaps:22/385 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKDLHVDDLMVGDEASQLRSLL 73
            ::.|||:|..|.|.:|...|.|:..|:||.|..:| :..|..:.|      ..||:||...:..|
  Rat    12 VIFDNGSGLCKAGLSGEIGPRHVTSSVVGYPKFKA-SPTGACQKK------YFVGEEALFKQETL 69

  Fly    74 EVSYPMENGVVRNWDDMCHVWDYTFGPKKMDIDPTNTKILLTEPPMNPTKNREKMIEVMFEKYGF 138
            .:..|:|.|::.:|||:..:|.:.| ..::.:.|:...:|:|||.:||.:||||..|||||.:..
  Rat    70 RLQSPIERGLITSWDDIEKLWRHLF-EWELGVKPSERPVLMTEPSLNPRENREKTAEVMFETFEV 133

  Fly   139 DSAYIAIQAVLTLYAQGLISGVVIDSGDGVTHICPVYEEFALPHLTRRLDIAGRDITRYLIKLLL 203
            .:.|::.||||.||:...::|:|:|||||||...|::|.::|||...:|.:||:|||..|.:|||
  Rat   134 PAFYLSDQAVLALYSSACVTGLVVDSGDGVTCTVPIFEGYSLPHAVSKLFVAGKDITELLTRLLL 198

  Fly   204 LRGYAFNHSADFETVRIMKEKLCYIGYDIEMEQRLALETTVLVESYTLPDGRVIKVGGERFEAPE 268
            ..|.||....|...|..:||||||:.  :|.|:.|:.....::..|.||||.||.:|.:.::|||
  Rat   199 ASGRAFPCPLDKALVDDIKEKLCYVA--LEPEEELSRRAEDVLREYKLPDGNVIYIGDQLYQAPE 261

  Fly   269 ALFQPHLINVEGPGIAELAFNTIQAADIDIRPELYKHIVLSGGSTMYPGLPSRLEREIKQLYLER 333
            .||.|..:...|||:|::|.|:|...|.||:..|:..||||||||::.||..||.:|::||..:.
  Rat   262 VLFSPDQLGTHGPGLAQMASNSIAKCDADIQKTLFGEIVLSGGSTLFQGLDDRLLKELEQLASKG 326

  Fly   334 VLKNDTEKLAKFKIRIEDPPRRKDMVFIGGAVLAEVTKDRDGFWMSKQEYQEQGLKVLQK 393
            |           .|:|..||.|....:||.:::..::..:. .|::..:::|.|:.|:|:
  Rat   327 V-----------PIKITAPPDRWFSTWIGASIVTSLSSFKQ-MWITAADFKEFGVSVVQR 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp2NP_001259621.1 ACTIN 6..393 CDD:214592 142/383 (37%)
Actrt2NP_001013959.1 NBD_sugar-kinase_HSP70_actin 6..377 CDD:302596 143/385 (37%)
ACTIN 10..377 CDD:214592 143/385 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.