DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp2 and Actl7a

DIOPT Version :9

Sequence 1:NP_001259621.1 Gene:Arp2 / 32623 FlyBaseID:FBgn0011742 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001011973.1 Gene:Actl7a / 298017 RGDID:1304697 Length:440 Species:Rattus norvegicus


Alignment Length:394 Identity:134/394 - (34%)
Similarity:213/394 - (54%) Gaps:36/394 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SKGR------NVIVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKDLHVDDLM 61
            ||.|      ..:|.|.||||.|||:||...|||...:.||:|.:... |.||      :..:..
  Rat    65 SKDRPRLEVTKAVVVDLGTGFCKCGFAGLPKPTHKISTTVGKPYMETA-KTGD------NRKETF 122

  Fly    62 VGDEASQLRSLLEVSYPMENGVVRNWDDMCHVWDYTFGPKKMDIDPTNTKILLTEPPMNPTKNRE 126
            ||.|.......|::..|:.:|::.:||.:..:|:|.| .::|.|.|....:|:::||::|..|||
  Rat   123 VGRELFNPDIHLKLVNPLRHGIIVDWDTVQDIWEYLF-RQEMKIAPEEHAVLVSDPPLSPHTNRE 186

  Fly   127 KMIEVMFEKYGFDSAYIAIQAVLTLYAQGLISGVVIDSGDGVTHICPVYEEFALPHLTRRLDIAG 191
            |..|::||.:...:.:||.|:.|::|:.|..||:|::.|.||:::.|:||.:.||.:|.|||.||
  Rat   187 KYAEMLFETFNTPAMHIAYQSRLSMYSYGRTSGLVVEVGHGVSYVVPIYEGYPLPSITGRLDYAG 251

  Fly   192 RDITRYLIKLLLLRGYAFNHSADFETVRIMKEKLCYIGYDIEMEQRLALETTVLVESYTLPDGRV 256
            .|:|.||:.|:...|..|:.. ....|..:|.|.|::..|...|:::......:  .||||||:.
  Rat   252 SDLTNYLMNLMNNCGKHFSED-HLSIVEDIKTKCCFVALDPIEEKKIPPSEHEI--HYTLPDGKE 313

  Fly   257 IKVGGERFEAPEALFQPHLINVEGPGIAELAFNTIQAADIDIRPELYKHIVLSGGSTMYPGLPSR 321
            |::|.|||...|..|:|.||.....|:.....:.:...||.::.:|..:|:|.|||||..|.|:|
  Rat   314 IRLGQERFLCSEMFFKPSLIKSMQLGLHTQTVSCLNKCDIALKRDLMGNILLCGGSTMLRGFPNR 378

  Fly   322 LEREIKQLYLERVLKNDTEKLAKFKIRIEDPPRRKDMVFIGGAVLAEVTKDRDGF---WMSKQEY 383
            |::|     |..:..|||.       ::...|.|...|:.||::||.:    .||   |:.:.||
  Rat   379 LQKE-----LSSMCPNDTP-------QVNVLPERDTAVWTGGSILASL----QGFQPLWVHRLEY 427

  Fly   384 QEQG 387
            :|.|
  Rat   428 EEHG 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp2NP_001259621.1 ACTIN 6..393 CDD:214592 132/391 (34%)
Actl7aNP_001011973.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
ACTL7A_N 6..70 CDD:293445 3/4 (75%)
Required for interaction with TES. /evidence=ECO:0000250 36..56
NBD_sugar-kinase_HSP70_actin 72..440 CDD:302596 131/387 (34%)
ACTIN 74..440 CDD:214592 131/385 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.