DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp2 and POTEH

DIOPT Version :9

Sequence 1:NP_001259621.1 Gene:Arp2 / 32623 FlyBaseID:FBgn0011742 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001129685.1 Gene:POTEH / 23784 HGNCID:133 Length:545 Species:Homo sapiens


Alignment Length:419 Identity:92/419 - (21%)
Similarity:143/419 - (34%) Gaps:136/419 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CDNGTGFVKCG----YAGSNFPTHIFPSMVGRPMIRA--VNKI------GDIEVKDLHV--DDLM 61
            |..|:|..|.|    |..|.|       |..|..:|.  ::|:      |.:..|||.|  .|..
Human   145 CCRGSGKNKVGPWGDYDDSAF-------MEPRYHVRREDLDKLHRAAWWGKVPRKDLIVMLKDTD 202

  Fly    62 VGDEASQLRSLLEVSYPMENGVVRN--WDDMC--HVWD---YTFGPKKMDIDPTNTKILLTEPPM 119
            :..:..|.|:.|.::....|..|..  .|..|  ::.|   .|...|.:........::|.|...
Human   203 MNKKDKQKRTALHLASANGNSEVVKLLLDRRCQLNILDNKKRTALTKAVQCQEDECALMLLEHGT 267

  Fly   120 NPTKNREKMIEVMFEKYGFDSAYIAIQAVLTLYAQG-LISGVVIDSGD--GVTH-ICPVYE--EF 178
            :|.         :.::||..:.:.||.....|.|:. |:.|..|:|.:  |:|. :..|:|  :.
Human   268 DPN---------IPDEYGNTALHYAIYNEDKLMAKALLLYGADIESKNKHGLTPLLLGVHEQKQQ 323

  Fly   179 ALPHLTRR------LDIAGRDI--------TRYLIKLLL---------------LRGYAFN--HS 212
            .:..|.::      ||..||..        :..::.|||               .|.||.:  |:
Human   324 VVKFLIKKKANLNALDRYGRTALILAVCCGSASIVSLLLEQNIDVSSQDLSGQTAREYAVSSRHN 388

  Fly   213 ADFETVRIMKEK--LCYIGYDIEMEQRLALETTVLVESYTLPDGRVIKVGGERFEAPEALFQPHL 275
            ...:.:...|||  |.....:...||.|.|  |...||..|.        |.....||.:.|...
Human   389 VICQLLSDYKEKQILKVSSENSNPEQDLKL--TSEEESQRLK--------GSENSQPEEMSQEPE 443

  Fly   276 INVEGPGIAELAFNTIQAADIDIRPELYKHIVLSGGSTMYPGLPSRL------------------ 322
            ||..|              |..:..|:.||     ||| :.|.|..|                  
Human   444 INKGG--------------DRKVEEEMKKH-----GST-HMGFPENLTNGATADNGDDGLIPPRK 488

  Fly   323 ----------EREIKQLYLERVLKNDTEK 341
                      :.|.:|.:.:.  :|||:|
Human   489 SRTPESQQFPDTENEQYHSDE--QNDTQK 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp2NP_001259621.1 ACTIN 6..393 CDD:214592 92/419 (22%)
POTEHNP_001129685.1 Ank_4 180..230 CDD:290365 11/49 (22%)
ANK 1 180..208 6/27 (22%)
ANK 204..329 CDD:238125 27/133 (20%)
ANK 2 209..238 7/28 (25%)
ANK repeat 211..240 CDD:293786 6/28 (21%)
Ank_2 214..306 CDD:289560 21/100 (21%)
ANK repeat 242..273 CDD:293786 5/39 (13%)
ANK 3 242..271 5/37 (14%)
ANK 270..394 CDD:238125 26/132 (20%)
ANK repeat 275..306 CDD:293786 10/30 (33%)
ANK 4 275..304 9/28 (32%)
Ank_2 280..372 CDD:289560 20/91 (22%)
ANK repeat 308..339 CDD:293786 5/30 (17%)
ANK 5 308..337 5/28 (18%)
ANK repeat 341..372 CDD:293786 5/30 (17%)
ANK 6 341..370 5/28 (18%)
ANK 7 374..404 7/29 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 406..524 31/142 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.