DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp2 and arp-11

DIOPT Version :9

Sequence 1:NP_001259621.1 Gene:Arp2 / 32623 FlyBaseID:FBgn0011742 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_501314.2 Gene:arp-11 / 183628 WormBaseID:WBGene00016793 Length:384 Species:Caenorhabditis elegans


Alignment Length:347 Identity:69/347 - (19%)
Similarity:122/347 - (35%) Gaps:74/347 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKDLHVDD---LMVGDEASQLRSLLEVSYPME 80
            :.|.||...|.||                    ::..:|||   |:..||...|.:....:...|
 Worm     3 RIGCAGEITPRHI--------------------IRTEYVDDEGKLITSDELLALNNRKTATKSTE 47

  Fly    81 NGVVRNWDDMCHVWDYTFGPKKMDI------DPTNTKILLTEPPMNPTKNREKMIEVMFEKYGFD 139
                 .::::.:        |.:.|      .||:..::..|........|..:.:::.||....
 Worm    48 -----YYEEILY--------KFLRIVFLKVLAPTDRPVIFVESIFMSESLRNTITKIVVEKIRCK 99

  Fly   140 SAYIAIQAVLTLYAQGLISGVVIDSGDGVTHICPVYEEFA-LPHLTRRLDIAGRDITRYLIKLL- 202
            |.......|...:.....:.:|:|.|.......|:.|... |........|.||.:.|.:.:.: 
 Worm   100 SLMFMPSHVCATFPFNTQNALVVDIGHSECIAVPIIEGVTMLNEFESARSICGRQLERRVREQME 164

  Fly   203 ----------LLRGYAFNHSADFETVRIMKE-KLCYIGYDIEMEQRL----ALETTVLVESYTLP 252
                      ..|....|...|.:..::::. .|..|..|.|..:..    |.|.....:..||.
 Worm   165 KYGQIAELNGERRAITENDWQDIDACKLIETLSLSLICLDKERAENWTKWEASEEGEKPDIETLC 229

  Fly   253 DGRVIKVGGERFEAPEALFQ------------PHLINVEGPGIAELAFNTIQAADIDIRPELYKH 305
            ..|:....|:.|..|..:|:            |...::..|   :|....:....||:|.:|:.:
 Worm   230 KERLFPNNGKIFVVPPVVFETSTEIFFNENLNPTSFDLSLP---KLLHKLVSKCPIDLRKKLFPN 291

  Fly   306 IVLSGGSTMYPGLPSRLEREIK 327
            |:|:||.:..|||..|||:||:
 Worm   292 ILLTGGVSTIPGLMKRLEQEIQ 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp2NP_001259621.1 ACTIN 6..393 CDD:214592 69/347 (20%)
arp-11NP_501314.2 NBD_sugar-kinase_HSP70_actin 3..368 CDD:302596 69/347 (20%)
ACTIN 3..367 CDD:214592 69/347 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.