DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp2 and Actl7a

DIOPT Version :9

Sequence 1:NP_001259621.1 Gene:Arp2 / 32623 FlyBaseID:FBgn0011742 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_033741.1 Gene:Actl7a / 11470 MGIID:1343051 Length:440 Species:Mus musculus


Alignment Length:395 Identity:136/395 - (34%)
Similarity:215/395 - (54%) Gaps:38/395 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SKGR------NVIVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKDLHVDDLM 61
            ||.|      ..:|.|.||||.|||:||...|||...:.||:|.:... |.||      :..:..
Mouse    65 SKDRPRLEVTKAVVVDLGTGFCKCGFAGLPKPTHKISTTVGKPYMETA-KTGD------NRKETF 122

  Fly    62 VGDEASQLRSLLEVSYPMENGVVRNWDDMCHVWDYTFGPKKMDIDPTNTKILLTEPPMNPTKNRE 126
            ||.|.......|::..|:.:|::.:||.:..:|:|.| .::|.|.|....:|:::||::|..|||
Mouse   123 VGHELFNPDIHLKLVNPLRHGIIVDWDTVQDIWEYLF-RQEMKIAPEEHAVLVSDPPLSPHTNRE 186

  Fly   127 KMIEVMFEKYGFDSAYIAIQAVLTLYAQGLISGVVIDSGDGVTHICPVYEEFALPHLTRRLDIAG 191
            |..|::||.:...:.:||.|:.|::|:.|..||:|::.|.||:::.|:||.:.||.:|.|||.||
Mouse   187 KYAEMLFETFNTPAMHIAYQSRLSMYSYGRTSGLVVEVGHGVSYVVPIYEGYPLPSITGRLDYAG 251

  Fly   192 RDITRYLIKLLLLRGYAFNHSADFETVRIMKEKLCYIGYD-IEMEQRLALETTVLVESYTLPDGR 255
            .|:|.||:.|:...|..|:.. ....|..:|.:.|::..| ||.::..|.|..:   .||||||:
Mouse   252 SDLTTYLMNLMNNSGKHFSED-HLGIVEDIKTRCCFVALDPIEEKKIPAPEHEI---HYTLPDGK 312

  Fly   256 VIKVGGERFEAPEALFQPHLINVEGPGIAELAFNTIQAADIDIRPELYKHIVLSGGSTMYPGLPS 320
            .|::|.|||...|..|:|.||.....|:.....:.:...||.::.:|..:|:|.|||||..|.|:
Mouse   313 EIRLGQERFLCSEMFFKPSLIKSMQLGLHTQTVSCLNKCDIALKRDLMGNILLCGGSTMLRGFPN 377

  Fly   321 RLEREIKQLYLERVLKNDTEKLAKFKIRIEDPPRRKDMVFIGGAVLAEVTKDRDGF---WMSKQE 382
            ||::|     |..:..|||.       ::...|.|...|:.||::||.:    .||   |:.:.|
Mouse   378 RLQKE-----LSSMCPNDTP-------QVNVLPERDTAVWTGGSILASL----QGFQPLWVHRLE 426

  Fly   383 YQEQG 387
            |:|.|
Mouse   427 YEEHG 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp2NP_001259621.1 ACTIN 6..393 CDD:214592 134/392 (34%)
Actl7aNP_033741.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
ACTL7A_N 6..70 CDD:293445 3/4 (75%)
Required for interaction with TES. /evidence=ECO:0000250 36..56
NBD_sugar-kinase_HSP70_actin 72..440 CDD:302596 133/388 (34%)
ACTIN 74..440 CDD:214592 133/386 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.