DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp2 and ACTL7A

DIOPT Version :9

Sequence 1:NP_001259621.1 Gene:Arp2 / 32623 FlyBaseID:FBgn0011742 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_006678.1 Gene:ACTL7A / 10881 HGNCID:161 Length:435 Species:Homo sapiens


Alignment Length:383 Identity:132/383 - (34%)
Similarity:212/383 - (55%) Gaps:32/383 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKDLHVDDLMVGDEASQLRSLL 73
            :|.|.|||:.|||:||...|||...:.||:|.:... |.||      :..:..||.|.:.....|
Human    72 VVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETA-KTGD------NRKETFVGQELNNTNVHL 129

  Fly    74 EVSYPMENGVVRNWDDMCHVWDYTFGPKKMDIDPTNTKILLTEPPMNPTKNREKMIEVMFEKYGF 138
            ::..|:.:|::.:||.:..:|:|.| .::|.|.|....:|:::||::|..||||..|::||.:..
Human   130 KLVNPLRHGIIVDWDTVQDIWEYLF-RQEMKIAPEEHAVLVSDPPLSPHTNREKYAEMLFEAFNT 193

  Fly   139 DSAYIAIQAVLTLYAQGLISGVVIDSGDGVTHICPVYEEFALPHLTRRLDIAGRDITRYLIKLLL 203
            .:.:||.|:.|::|:.|..||:|::.|.||:::.|:||.:.||.:|.|||.||.|:|.||:.||.
Human   194 PAMHIAYQSRLSMYSYGRTSGLVVEVGHGVSYVVPIYEGYPLPSITGRLDYAGSDLTAYLLGLLN 258

  Fly   204 LRGYAFNHSADFETVRIMKEKLCYIGYDIEMEQRLAL-ETTVLVESYTLPDGRVIKVGGERFEAP 267
            ..|..|... ....|..:|:|.|::..|...|:::.| |.|:   .|.||||:.|::..|||...
Human   259 SAGNEFTQD-QMGIVEDIKKKCCFVALDPIEEKKVPLSEHTI---RYVLPDGKEIQLCQERFLCS 319

  Fly   268 EALFQPHLINVEGPGIAELAFNTIQAADIDIRPELYKHIVLSGGSTMYPGLPSRLEREIKQLYLE 332
            |..|:|.||.....|:.....:.:...||.::.:|..:|:|.|||||..|.|:||::|     |.
Human   320 EMFFKPSLIKSMQLGLHTQTVSCLNKCDIALKRDLMGNILLCGGSTMLSGFPNRLQKE-----LS 379

  Fly   333 RVLKNDTEKLAKFKIRIEDPPRRKDMVFIGGAVLAEVTKDRDGF---WMSKQEYQEQG 387
            .:..|||.       ::...|.|...|:.||::||.:    .||   |:.:.||:|.|
Human   380 SMCPNDTP-------QVNVLPERDSAVWTGGSILASL----QGFQPLWVHRFEYEEHG 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp2NP_001259621.1 ACTIN 6..393 CDD:214592 132/383 (34%)
ACTL7ANP_006678.1 ACTL7A_N 1..65 CDD:293445
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..64
Required for interaction with TES 31..51
NBD_sugar-kinase_HSP70_actin 67..435 CDD:302596 132/383 (34%)
ACTIN 69..435 CDD:214592 132/383 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.