DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp2 and ACTL7B

DIOPT Version :9

Sequence 1:NP_001259621.1 Gene:Arp2 / 32623 FlyBaseID:FBgn0011742 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_006677.1 Gene:ACTL7B / 10880 HGNCID:162 Length:415 Species:Homo sapiens


Alignment Length:380 Identity:133/380 - (35%)
Similarity:208/380 - (54%) Gaps:25/380 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKDLHVDDLMVGDEASQLRSLL 73
            ::.|.|:.:.||||||...||:...|.||:....|.: .||.....|      ||.|.....:.|
Human    52 VIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAAD-AGDTRKWTL------VGHELLNTEAPL 109

  Fly    74 EVSYPMENGVVRNWDDMCHVWDYTFGPKKMDIDPTNTKILLTEPPMNPTKNREKMIEVMFEKYGF 138
            ::..|:::|:|.:||.:..:|:|.| ...|.|.|....:|:::||::|:.||||..|:|||.:|.
Human   110 KLVNPLKHGIVVDWDCVQDIWEYIF-RTAMKILPEEHAVLVSDPPLSPSSNREKYAELMFETFGI 173

  Fly   139 DSAYIAIQAVLTLYAQGLISGVVIDSGDGVTHICPVYEEFALPHLTRRLDIAGRDITRYLIKLLL 203
            .:.::..|::|::|:.|..||:|::||.||:|:.|:.|...||.||.|.|.||.|:|.||::||.
Human   174 PAMHVTSQSLLSIYSYGKTSGLVVESGHGVSHVVPISEGDVLPGLTSRADYAGGDLTNYLMQLLN 238

  Fly   204 LRGYAFNHSADFETVRIMKEKLCYIGYDIEMEQRLALETTVLVESYTLPDGRVIKVGGERFEAPE 268
            ..|:||... ....:..:|:|.||..:  ..|:.|.|....|...|.||||::|.:|.|||...|
Human   239 EAGHAFTDD-HLHIIEHIKKKCCYAAF--LPEEELGLVPEELRVDYELPDGKLITIGQERFRCSE 300

  Fly   269 ALFQPHLINVEGPGIAELAFNTI-QAADIDIRPELYKHIVLSGGSTMYPGLPSRLEREIKQLYLE 332
            .||||.|.....||:.||....: :..|...:.|:..:::|.||.||..|.|.|.:||:..|   
Human   301 MLFQPSLAGSTQPGLPELTAACLGRCQDTGFKEEMAANVLLCGGCTMLDGFPERFQRELSLL--- 362

  Fly   333 RVLKNDTEKLAKFKIRIEDPPRRKDMVFIGGAVLAEVTKDRDGFWMSKQEYQEQG 387
              ...|:..:|.       .|.||..|:.||::||.:...:. .|:||:|::|:|
Human   363 --CPGDSPAVAA-------APERKTSVWTGGSILASLQAFQQ-LWVSKEEFEERG 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp2NP_001259621.1 ACTIN 6..393 CDD:214592 133/380 (35%)
ACTL7BNP_006677.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
NBD_sugar-kinase_HSP70_actin 51..415 CDD:327376 133/380 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.