DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp2 and LOC100288966

DIOPT Version :9

Sequence 1:NP_001259621.1 Gene:Arp2 / 32623 FlyBaseID:FBgn0011742 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001244291.1 Gene:LOC100288966 / 100288966 -ID:- Length:584 Species:Homo sapiens


Alignment Length:224 Identity:49/224 - (21%)
Similarity:81/224 - (36%) Gaps:59/224 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 DIDPTNTKILLTEPPMNPTKNREKMIEVMFEKYGFDSAYIAIQAVLTLYAQ-GLISGVVIDSGDG 167
            ||:..| |..||...:...:.::::::.:.:|.       |...||..|.: .||..|...|...
Human   264 DIESKN-KCGLTPLLLGVHEQKQQVVKFLIKKK-------ANLNVLDRYGRTALILAVCCGSASI 320

  Fly   168 VTHICPVYEEFALPHLTRRLDIAGRDITRYLIKLLLLRGYAF--NHSADFETVRIMKEK--LCYI 228
            |..:           |.:.:|::.:|::..     ..|.||.  :|....|.:...|||  |...
Human   321 VNLL-----------LEQNVDVSSQDLSGQ-----TAREYAVSSHHHVICELLSDYKEKQMLKIS 369

  Fly   229 GYDIEMEQRLALETTVLVESYTLPDGRVIKVGGERFEAPEALFQPHLINVEGPGIAELAFNTIQA 293
            ..:...||.|.|.:.        .:.:.:||...  ..||.:.|...||.:              
Human   370 SENSNPEQDLKLTSE--------EESQRLKVSEN--SQPEKMSQEPEINKD-------------- 410

  Fly   294 ADIDIRPELYKHIVLSGGSTMYPGLPSRL 322
            .|.::..|:.||     ||... |||..|
Human   411 CDREVEEEIKKH-----GSNPV-GLPENL 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp2NP_001259621.1 ACTIN 6..393 CDD:214592 49/224 (22%)
LOC100288966NP_001244291.1 Ank_4 143..193 CDD:290365
ANK 167..292 CDD:238125 6/28 (21%)
ANK repeat 174..203 CDD:293786
Ank_2 177..269 CDD:289560 2/4 (50%)
ANK repeat 205..236 CDD:293786
ANK 233..357 CDD:238125 24/116 (21%)
ANK repeat 238..269 CDD:293786 2/4 (50%)
Ank_2 243..335 CDD:289560 18/89 (20%)
ANK repeat 271..302 CDD:293786 5/37 (14%)
ANK repeat 304..335 CDD:293786 8/41 (20%)
SH3_and_anchor <440..556 CDD:275056
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.