DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp2 and POTEB2

DIOPT Version :9

Sequence 1:NP_001259621.1 Gene:Arp2 / 32623 FlyBaseID:FBgn0011742 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001264232.1 Gene:POTEB2 / 100287399 HGNCID:48327 Length:544 Species:Homo sapiens


Alignment Length:348 Identity:64/348 - (18%)
Similarity:124/348 - (35%) Gaps:104/348 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 DIDPTNTKILLTEPPMNPTKNREKMIEVMFEKYGFDSAYIAIQAVLTLYAQ-GLISGVVIDSGDG 167
            ||:..| |..||...:...:.::::::.:.:|....:|       |..|.: .||..|...|...
Human   227 DIESKN-KCGLTPLLLGVHEQKQEVVKFLIKKKANLNA-------LDRYGRTALILAVCCGSASI 283

  Fly   168 VTHICPVYEEFALPHLTRRLDIAGRDITRYLIKLLLLRGYAF--NHSADFETVRIMKEK--LCYI 228
            |..:           |.:.:|::.:|::..     ..|.||.  :|....|.:...|||  |...
Human   284 VNLL-----------LEQNVDVSSQDLSGQ-----TAREYAVSSHHHVICELLSDYKEKQMLKIS 332

  Fly   229 GYDIEMEQRLALETTVLVESYTLPDGRVIKVGGERFEAPEALFQPHLINVEGPGIAELAFNTIQA 293
            ..:...||.|.|.:.        .:.:.:||...  ..||.:.|...||.:              
Human   333 SENSNPEQDLKLTSE--------EESQRLKVSEN--SQPEKMSQEPEINKD-------------- 373

  Fly   294 ADIDIRPELYKH--------IVLSGGSTMYPG----LPSRLER----------EIKQLYLERVLK 336
            .|.::..|:.||        ..|:.|::...|    :|.|..|          |.::.:.:.  :
Human   374 CDREVEEEIKKHGSNPVGLPENLTNGASAGNGDDGLIPQRKSRKPENQQFPDTENEEYHSDE--Q 436

  Fly   337 NDTEK---------------LAKFKIRIE------------DPPRRKDMVFIGGAVLAEVTKDRD 374
            |||:|               |...:.:||            ...:.:|::.....:..|:.|.|.
Human   437 NDTQKQLSEEQNTGISQDEILTNKQKQIEVAEKEMNSELSLSHKKEEDLLRENSMLREEIAKLRL 501

  Fly   375 GFWMSKQEYQEQGLKVLQKLQKI 397
            ....:|.:.|.:..|:|::::.:
Human   502 ELDETKHQNQLRENKILEEIESV 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp2NP_001259621.1 ACTIN 6..393 CDD:214592 64/342 (19%)
POTEB2NP_001264232.1 ANK 130..255 CDD:238125 6/28 (21%)
ANK 1 135..167
ANK repeat 137..166 CDD:293786
ANK 2 168..200
ANK repeat 168..199 CDD:293786
ANK 196..320 CDD:238125 23/116 (20%)
ANK 3 201..233 3/6 (50%)
ANK repeat 201..232 CDD:293786 2/4 (50%)
ANK 4 234..266 5/38 (13%)
ANK repeat 234..265 CDD:293786 4/37 (11%)
ANK 5 267..299 8/42 (19%)
ANK repeat 267..298 CDD:293786 8/41 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 332..457 26/150 (17%)
SMC_N <412..>542 CDD:330553 18/115 (16%)
CCDC144C 489..>542 CDD:317340 7/36 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.