DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp2 and actr3b

DIOPT Version :9

Sequence 1:NP_001259621.1 Gene:Arp2 / 32623 FlyBaseID:FBgn0011742 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_005162538.1 Gene:actr3b / 100038776 ZFINID:ZDB-GENE-070424-10 Length:419 Species:Danio rerio


Alignment Length:419 Identity:139/419 - (33%)
Similarity:209/419 - (49%) Gaps:58/419 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKDL--HVDDL--MVGDEASQLR 70
            |.|.|||:.|.||||:..|..|.|:.:.   :|....:||...:.|  .||||  .:||||.. :
Zfish    10 VIDCGTGYTKIGYAGNTEPQFIMPTCIA---VRESASVGDQAQRRLVKGVDDLDFFIGDEAID-K 70

  Fly    71 SLLEVSYPMENGVVRNWDDMCHVWDYTFGPKKMDIDPTNTKILLTEPPMNPTKNREKMIEVMFEK 135
            ......:|:.:|::.:||.|....:.... |.:..:|.:...|:||||:|..:|||.:.|:|||.
Zfish    71 PNYATKWPIRHGIIEDWDFMEKFMEQVIF-KYLRAEPEDHNFLMTEPPLNTPENREYLAEIMFET 134

  Fly   136 YGFDSAYIAIQAVLTLYA--------QGLISGVVIDSGDGVTHICPVYEEFALPHLTRRLDIAGR 192
            :.....|||:||||.|.|        :..::|:||||||||||..||.|.:.:....:.:.||||
Zfish   135 FNVPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHAIPVAEGYVIGSCIKHIPIAGR 199

  Fly   193 DITRYLIKLLLLRGYAFNHSADFETVRIMKEKLCYIGYDIEMEQRLALETTVLVESYTLPDGRVI 257
            |||.::.:||..|..........||.:.:||:.|||..||..|          ...|.:..|:.|
Zfish   200 DITYFIQQLLREREIGIPPEQSLETAKAVKERYCYICPDIVKE----------FTKYDMDPGKWI 254

  Fly   258 K----------------VGGERFEAPEALFQPHLINVE--GPGIAELAFNTIQAADIDIRPELYK 304
            |                ||.|||..||..|.|...|.:  .| |:::....||...||:|..|||
Zfish   255 KKYKGINAISKNEFQIDVGYERFLGPEIFFHPEFANPDFMQP-ISDVVDEVIQNCPIDVRRPLYK 318

  Fly   305 HIVLSGGSTMYPGLPSRLEREIK-----QLYLERVLKNDTEKLAKFKIRIEDPPRRKDMVFIGGA 364
            :|||||||||:.....||:|::|     :|.|...|.....|....::::.....::..|:.||:
Zfish   319 NIVLSGGSTMFRDFGRRLQRDLKRVVDARLRLSEELSGGRIKPKPMEVQVISHHMQRYAVWFGGS 383

  Fly   365 VLAEVTKDRDGFWM---SKQEYQEQGLKV 390
            :||...:    |:.   :|::|:|.|.::
Zfish   384 MLASTPE----FFQVCHTKKDYEEYGPRI 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp2NP_001259621.1 ACTIN 6..393 CDD:214592 139/419 (33%)
actr3bXP_005162538.1 COG5277 1..411 CDD:227602 139/419 (33%)
PTZ00280 3..416 CDD:240343 139/419 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.