DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32650 and ADCK2

DIOPT Version :9

Sequence 1:NP_727647.1 Gene:CG32650 / 326227 FlyBaseID:FBgn0052650 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_443085.2 Gene:ADCK2 / 90956 HGNCID:19039 Length:626 Species:Homo sapiens


Alignment Length:132 Identity:39/132 - (29%)
Similarity:55/132 - (41%) Gaps:29/132 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 VAHEMCLGSTR--------SLL--------ARVRDLELGLAP--------LGFSRPSVMS-RKIG 272
            |:..:||...|        |||        ||:..|.||..|        :|...|.|:| |::.
Human     7 VSVRVCLSHLRCFELRQGLSLLRPSECPRDARLCWLLLGTLPKVVSLCGDVGEGAPDVLSRRRVR 71

  Fly   273 SLGTSGAGHADS-NRAEEHPGRPVWVKAKAWQRRSYRTVKFSRGELL-ELPVVVPPEAKTWYGKM 335
            ..|.:|||.|:| .||....|  |::..:.|.|.....|||....|| .|..:.|..:..|...:
Human    72 CSGAAGAGPAESLPRAGPLGG--VFLHLRLWLRAGALLVKFFPLLLLYPLTYLAPSVSTLWLHLL 134

  Fly   336 LR 337
            |:
Human   135 LK 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32650NP_727647.1 DUF4763 30..253 CDD:292582 9/35 (26%)
ADCK2NP_443085.2 AarF 134..618 CDD:223733 1/3 (33%)
ADCK2-like 169..553 CDD:270873
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.