DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32650 and COQ8

DIOPT Version :9

Sequence 1:NP_727647.1 Gene:CG32650 / 326227 FlyBaseID:FBgn0052650 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_011396.1 Gene:COQ8 / 852758 SGDID:S000003087 Length:501 Species:Saccharomyces cerevisiae


Alignment Length:214 Identity:45/214 - (21%)
Similarity:73/214 - (34%) Gaps:66/214 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 SALDRLFQRQTKELVGCRQDHERVLSFHLTKQL--EAGKCLQRYR--------------YARDLY 190
            |.:||:..:.:| :.|......::|||...|.|  |..:.|.|.:              .|::|.
Yeast   116 SNIDRITNKFSK-MRGVALKIGQLLSFQDEKVLPKELYEILSRVQNSANHMPQRQLEKVMAKELG 179

  Fly   191 ASWRELFKMGRHLKEAYKKI----------LERTQSRLEYAEIKRQALDEMTVAHEMCLGSTRSL 245
            |:|:..|.....:..|...|          .:|...:::|..:| :::|.       .|.|...|
Yeast   180 ANWKTKFSKFDKIPMAAASIGQVHAAELPSGQRVVVKIQYPGVK-ESIDS-------DLNSLLML 236

  Fly   246 LARVRDLELGLAPLGFSRPSVMSRKIGSLGTSGAGHADSNRAEEHPGRPVWVKAKAWQRRSYRTV 310
            |.....|..||         .:.:.|.:..|......|.||           :|:|.|       
Yeast   237 LTASSLLPKGL---------FLDKTIANARTELKWECDYNR-----------EARALQ------- 274

  Fly   311 KFSR----GELLELPVVVP 325
            ||..    ....|:|.|.|
Yeast   275 KFEALLKDDPAFEVPHVFP 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32650NP_727647.1 DUF4763 30..253 CDD:292582 28/136 (21%)
COQ8NP_011396.1 ABC1_ADCK3 153..403 CDD:270872 34/176 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.