DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32650 and MCP2

DIOPT Version :9

Sequence 1:NP_727647.1 Gene:CG32650 / 326227 FlyBaseID:FBgn0052650 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_013354.1 Gene:MCP2 / 850955 SGDID:S000004243 Length:569 Species:Saccharomyces cerevisiae


Alignment Length:265 Identity:53/265 - (20%)
Similarity:94/265 - (35%) Gaps:67/265 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 PEDSRWMIMHGSREAALRELQWNNLRIRRQLADLVRCSELGRARISALDRLFQRQTKELVGCRQD 161
            |...:.:::.|:..:|:....:|:     ...|.|:.:.|...||:.:       |:....|...
Yeast    30 PRTRKSLLVGGTIASAVVLYNFND-----TFHDSVKHTALTTKRIAVV-------TQATTRCFYH 82

  Fly   162 HERVL--SFHLTKQLEA--GKC--------LQRYRYARDLYASWRELFKMGRHLKEAYKKILERT 214
            ::|.|  |:...|:.|.  .||        |...|....:|      .|:|:|:           
Yeast    83 YKRALNKSYENKKEREVALNKCHKMCALITLHALRSNGGIY------IKLGQHI----------- 130

  Fly   215 QSRLEYAEIKRQALDEMTVAHEMCLGST---------RSLLARVRD--LELGLAPLGFSRPSVMS 268
             ..:.|. :.::..|.|....:.|..||         ..|...:.|  ||....|:|.:  |:..
Yeast   131 -GAMTYL-LPKEWTDTMIPLQDHCPESTYEEIDELFKEDLGTSIEDMFLEFNKTPIGVA--SLAQ 191

  Fly   269 RKIGSLGTS-GAGHADSNRAEEHPGRPVWVKAKAWQRRSYRTVKFSRGELLELPVVVPPEAKTWY 332
            ..:..|..| |.|.:.:.:. :||....::.......|:.       .|||:  |..|....||.
Yeast   192 VHVAKLKNSDGKGSSVAVKC-QHPSLKEFIPLDVMLTRTV-------FELLD--VFFPDYPLTWL 246

  Fly   333 GKMLR 337
            |..|:
Yeast   247 GDELQ 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32650NP_727647.1 DUF4763 30..253 CDD:292582 32/178 (18%)
MCP2NP_013354.1 AarF 47..569 CDD:223733 50/248 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.