DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32650 and Coq8b

DIOPT Version :9

Sequence 1:NP_727647.1 Gene:CG32650 / 326227 FlyBaseID:FBgn0052650 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_598531.2 Gene:Coq8b / 76889 MGIID:1924139 Length:533 Species:Mus musculus


Alignment Length:239 Identity:57/239 - (23%)
Similarity:82/239 - (34%) Gaps:79/239 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 EIGAM-NRTLDEIQAQLAIDFHERDGG------------RSCWEE--EQEALAKGLEPEDSRWMI 104
            |:||| .||...:...:.:..    ||            |||..:  .|:...:||..:|.|   
Mouse     4 ELGAMLRRTCGPLGRAVRLPC----GGALGPRPHWWGPCRSCLAQSVHQDQPGRGLSEDDIR--- 61

  Fly   105 MHGSREAALRELQWNNLRIRRQLADLVRCSELGRARIS------------ALDRLFQRQTKELVG 157
              .:|||.||:..      |.||:|..|..::..:|||            .|..|.:...|.|.|
Mouse    62 --RAREARLRKAP------RPQLSDRSRERKVPASRISRLASFGGLAVGLGLGALAEVTKKSLPG 118

  Fly   158 CRQDHERVL---SFHLTKQLEAGKCLQRYRYARDLYASWRELFKMGRHL--------KEAYKKIL 211
            ....||.|.   |.....:..|.:.:|.....|.      ...|:|:.|        ....::|.
Mouse   119 GSLQHEGVSGLGSSPFLSEANAERIVQTLCTVRG------AALKIGQMLSIQDNSFISPQLQRIF 177

  Fly   212 ERTQSRLEYAEIKRQALDEMTVAHEMCLGSTRSLLARVRDLELG 255
            ||.          ||:.|.|          .|..:.||.:.|||
Mouse   178 ERV----------RQSADFM----------PRWQMMRVLEEELG 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32650NP_727647.1 DUF4763 30..253 CDD:292582 54/235 (23%)
Coq8bNP_598531.2 KxGQ motif. /evidence=ECO:0000250|UniProtKB:Q8NI60 156..159 1/2 (50%)
ABC1_ADCK3 176..425 CDD:270872 13/46 (28%)
AAAS motif. /evidence=ECO:0000250|UniProtKB:Q8NI60 217..220
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.