DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32650 and Adck5

DIOPT Version :9

Sequence 1:NP_727647.1 Gene:CG32650 / 326227 FlyBaseID:FBgn0052650 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001261705.1 Gene:Adck5 / 39260 FlyBaseID:FBgn0036142 Length:557 Species:Drosophila melanogaster


Alignment Length:254 Identity:48/254 - (18%)
Similarity:85/254 - (33%) Gaps:90/254 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 SREAALRELQWNNLRIRRQLADLVR--------------------CSELGRARISALDRLFQRQT 152
            |.|....::|:|:|: :|.::||..                    .::|.:..:..|:.|.:.|.
  Fly   195 SGEQVAVKVQYNDLQ-KRFISDLGTIIFLQDIVEFFFKDYNFGWILNDLRKNLVLELNFLQEGQN 258

  Fly   153 KELVGCRQDHERVLSFHLTKQLEAGKCLQRYRYARDLYASWRELFKMGRHLKEAYKKILERTQSR 217
            .|  .|.:|.|:....|:.      |....|...|.|...|.:..|:      :..|.:|:.:..
  Fly   259 AE--RCAKDMEKFSYVHVP------KVHWSYTKTRVLTLEWMDGCKI------SDLKTIEKEKLS 309

  Fly   218 LEYAEIKR-QALDEMTVAHEMCLGSTRSLLARVRDLELGLAPLGFSRPSVMSRKIGSLGTSGAGH 281
            |:..::|. :|..|                                          .:..:|..|
  Fly   310 LKDIDVKLFEAFAE------------------------------------------QIFYTGFVH 332

  Fly   282 ADSNRAEEHPGRPVWVKAKAWQRRSYRT--VKFSRGELLELPV-VVPPEAKTWYGKMLR 337
            ||     .|||. ::|:.   .|::.|.  :....|...|||. |..|..:.|...:||
  Fly   333 AD-----PHPGN-IFVRK---NRKNGRADIILLDHGLYEELPQNVRGPLCEFWEATVLR 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32650NP_727647.1 DUF4763 30..253 CDD:292582 29/165 (18%)
Adck5NP_001261705.1 AarF 98..469 CDD:223733 48/254 (19%)
ADCK1-like 144..395 CDD:270871 48/254 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0661
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.