DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32650 and Adck2

DIOPT Version :9

Sequence 1:NP_727647.1 Gene:CG32650 / 326227 FlyBaseID:FBgn0052650 Length:346 Species:Drosophila melanogaster
Sequence 2:XP_008761004.1 Gene:Adck2 / 312258 RGDID:1311058 Length:641 Species:Rattus norvegicus


Alignment Length:134 Identity:35/134 - (26%)
Similarity:53/134 - (39%) Gaps:33/134 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 QSRLEYAEIKRQALDEMTVAHE---------MCLGSTRS-LLARVRDLELGLAPLGFSRPSVMSR 269
            |.:..::.:....|  :.||.|         :|||.... |||:...| |.|.||.:..|...:.
  Rat    67 QRKTHWSNLPENGL--VKVAQEGPLARILLCLCLGLRAGVLLAKFLPL-LFLYPLTYLAPGFSTL 128

  Fly   270 KIGSLGTSGAGHADSNRAEEHPGRPVWVKAKAW--QRRSYRT----VKFSRGELLELPVVVPPEA 328
            .:..|          .:|.|..| |.::|...|  .||...:    |:||:   |.:.|...|.|
  Rat   129 WLHLL----------FKATETSG-PTYIKLGQWASTRRDLFSEAFCVQFSK---LHVQVTPHPWA 179

  Fly   329 KTWY 332
            :|.|
  Rat   180 RTEY 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32650NP_727647.1 DUF4763 30..253 CDD:292582 11/47 (23%)
Adck2XP_008761004.1 AarF 133..>518 CDD:223733 18/65 (28%)
ADCK2-like 168..543 CDD:270873 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.