DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32650 and Coq8b

DIOPT Version :9

Sequence 1:NP_727647.1 Gene:CG32650 / 326227 FlyBaseID:FBgn0052650 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001012065.1 Gene:Coq8b / 308453 RGDID:1311356 Length:528 Species:Rattus norvegicus


Alignment Length:284 Identity:56/284 - (19%)
Similarity:100/284 - (35%) Gaps:85/284 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 EIGAMNRTLD---------EIQAQLAIDFHERDGGRSCWEE--EQEALAKGLEPEDSRWMIMHGS 108
            |:|||.||..         .....|.:..|.....|.|..:  .|:...:||..::.|     .:
  Rat     4 ELGAMLRTTCGPLGRAVRLPCAGALRLRPHWWGPCRDCLAQRVHQDQPGRGLTEDEIR-----RA 63

  Fly   109 REAALRELQWNNLRIRRQLADLVRCSELGRARIS------------ALDRLFQRQTKELVGCRQD 161
            |||.||:..      |.||:|..|..::..:|||            .|..|.:...|.|.|....
  Rat    64 REARLRKAP------RPQLSDRSRERKVPASRISRLASFGGLAVGLGLGALAEVTKKSLPGGSLQ 122

  Fly   162 HE-----------------------------RVLSFH----LTKQLEAGKCLQRYRYARDLYASW 193
            ||                             ::||..    ::.||:  :..:|.|.:.|....|
  Rat   123 HEGSSPFLTEANAERIVQTLCTVRGAALKIGQMLSIQDNSLISPQLQ--RVFERVRQSADFMPRW 185

  Fly   194 REL----FKMGRHLKEAYKKILERTQSRLEYAEIKRQALDEMT----------VAHEMCLGSTRS 244
            :.:    .::|:..::....:.|...:.....::.:..|.:.|          || |......::
  Rat   186 QMMKVLEEELGKDWQDKVASLEEVPFAAASIGQVHQGVLKDGTEVAVKIQYPGVA-ESIQSDVQN 249

  Fly   245 LLARVRDLELGLAPLGFSRPSVMS 268
            |||.:: :.:||....|:..|:.:
  Rat   250 LLALLK-MSVGLPEGLFAEQSLQT 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32650NP_727647.1 DUF4763 30..253 CDD:292582 52/267 (19%)
Coq8bNP_001012065.1 KxGQ motif. /evidence=ECO:0000250|UniProtKB:Q8NI60 151..154 0/2 (0%)
ABC1_ADCK3 171..420 CDD:270872 18/104 (17%)
AAAS motif. /evidence=ECO:0000250|UniProtKB:Q8NI60 212..215 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.