DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32650 and coq-8

DIOPT Version :9

Sequence 1:NP_727647.1 Gene:CG32650 / 326227 FlyBaseID:FBgn0052650 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_498014.2 Gene:coq-8 / 175647 WormBaseID:WBGene00000767 Length:755 Species:Caenorhabditis elegans


Alignment Length:184 Identity:37/184 - (20%)
Similarity:58/184 - (31%) Gaps:74/184 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 RRQLADLVRCSELGRARISALDRLFQRQTKELVGCRQD-------HERVLSFHLTKQLEAGK--- 178
            ||:|..  .|.....||.       .::.:||:...||       .|...|..||.:|..||   
 Worm   498 RRELKQ--ECDYEREARA-------MKKFRELIADWQDVYVPEVIDELSSSRVLTTELVYGKPVD 553

  Fly   179 -CLQRYRYARDLYAS------------WREL--------FKMGRH-------------------- 202
             |::..:..||..|.            ||.:        |.:|:|                    
 Worm   554 ACVEEPQVVRDYIAGKFIELCLKEIFLWRFMQTDPNWSNFFLGKHPKTGEPRLVLLDFGASRAYG 618

  Fly   203 ----------LKEAY----KKILERTQSRLEYAEIKRQALDEMTVAHEMCLGST 242
                      :|.||    |||:|.::........:...:::..|...|.:|.|
 Worm   619 KKFVDIYMNIIKSAYDGDKKKIIEYSREIGFLTGYETSVMEDAHVESVMIMGET 672

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32650NP_727647.1 DUF4763 30..253 CDD:292582 37/184 (20%)
coq-8NP_498014.2 AarF 298..>707 CDD:223733 37/184 (20%)
ABC1_ADCK3 394..648 CDD:270872 33/158 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.