DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32650 and adck5

DIOPT Version :10

Sequence 1:NP_727647.1 Gene:CG32650 / 326227 FlyBaseID:FBgn0052650 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001189455.1 Gene:adck5 / 100001584 ZFINID:ZDB-GENE-081104-149 Length:579 Species:Danio rerio


Alignment Length:37 Identity:13/37 - (35%)
Similarity:17/37 - (45%) Gaps:0/37 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 PSVMSRKIGSLGTSGAGHADSNRAEEHPGRPVWVKAK 300
            |..|.|.......:.|..|..::||.|.|.||.||.:
Zfish   194 PDKMFRTFDYEPVAAASLAQVHKAELHDGTPVAVKVQ 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32650NP_727647.1 DUF4763 23..253 CDD:406386
adck5NP_001189455.1 ADCK1-like 169..420 CDD:270871 13/37 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.