powered by:
Protein Alignment CG32650 and adck5
DIOPT Version :9
Sequence 1: | NP_727647.1 |
Gene: | CG32650 / 326227 |
FlyBaseID: | FBgn0052650 |
Length: | 346 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001189455.1 |
Gene: | adck5 / 100001584 |
ZFINID: | ZDB-GENE-081104-149 |
Length: | 579 |
Species: | Danio rerio |
Alignment Length: | 37 |
Identity: | 13/37 - (35%) |
Similarity: | 17/37 - (45%) |
Gaps: | 0/37 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 264 PSVMSRKIGSLGTSGAGHADSNRAEEHPGRPVWVKAK 300
|..|.|.......:.|..|..::||.|.|.||.||.:
Zfish 194 PDKMFRTFDYEPVAAASLAQVHKAELHDGTPVAVKVQ 230
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG32650 | NP_727647.1 |
DUF4763 |
30..253 |
CDD:292582 |
|
adck5 | NP_001189455.1 |
AarF |
78..499 |
CDD:223733 |
13/37 (35%) |
ADCK1-like |
169..420 |
CDD:270871 |
13/37 (35%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0661 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.