DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32650 and adck5

DIOPT Version :9

Sequence 1:NP_727647.1 Gene:CG32650 / 326227 FlyBaseID:FBgn0052650 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001189455.1 Gene:adck5 / 100001584 ZFINID:ZDB-GENE-081104-149 Length:579 Species:Danio rerio


Alignment Length:37 Identity:13/37 - (35%)
Similarity:17/37 - (45%) Gaps:0/37 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 PSVMSRKIGSLGTSGAGHADSNRAEEHPGRPVWVKAK 300
            |..|.|.......:.|..|..::||.|.|.||.||.:
Zfish   194 PDKMFRTFDYEPVAAASLAQVHKAELHDGTPVAVKVQ 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32650NP_727647.1 DUF4763 30..253 CDD:292582
adck5NP_001189455.1 AarF 78..499 CDD:223733 13/37 (35%)
ADCK1-like 169..420 CDD:270871 13/37 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.