DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32647 and DGCR2

DIOPT Version :9

Sequence 1:NP_001285168.1 Gene:CG32647 / 326226 FlyBaseID:FBgn0052647 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_005128.1 Gene:DGCR2 / 9993 HGNCID:2845 Length:550 Species:Homo sapiens


Alignment Length:232 Identity:55/232 - (23%)
Similarity:87/232 - (37%) Gaps:59/232 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 QTTWRRQRGCCTTTTTAAIRNMQQQKQKQQQQS------------YLQRLKAAGRL--GAWPPPM 87
            ||..|......|.:|...:|.:..|:..|.::|            |...:....|.  |.|....
Human   143 QTCQRLNGSLATFSTDQELRFVLAQEWDQPERSFGWKDQRKLWVGYQYVITGRNRSLEGRWEVAF 207

  Fly    88 --TSLLWLPTDYLAQLILA-----LCL-LGCL---------------------SPFTAALEEDCV 123
              :|.::||.|.:....::     .|. |.|.                     |.|.....:.||
Human   208 KGSSEVFLPPDPIFASAMSENDNVFCAQLQCFHFPTLRHHDLHSWHAESCYEKSSFLCKRSQTCV 272

  Fly   124 DFQGNKVNHGMLYVP-GPGVCSLCVCYHSEPLWCKAIYCDPPYFCKNFRVG-ERCCEFECLDPPG 186
            |.:.|.|:.|..:.| |...|..|.|:..||..|.|..|:.|..|:.:|.. :.||:|.||||.|
Human   273 DIKDNVVDEGFYFTPKGDDPCLSCTCHGGEPEMCVAALCERPQGCQQYRKDPKECCKFMCLDPDG 337

  Fly   187 EDKLYQERMRKRAEILAGNSTASNVQLAPIAMSTIML 223
             :.|:             :|.||.::|....:|:.::
Human   338 -NSLF-------------DSMASGMRLVVSCISSFLI 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32647NP_001285168.1 VWC 130..178 CDD:302663 16/49 (33%)
DGCR2NP_005128.1 LDLa 30..66 CDD:238060
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 69..92
CLECT_DGCR2_like 115..267 CDD:153069 22/123 (18%)
VWC 271..329 CDD:214564 20/57 (35%)
Atrophin-1 <428..537 CDD:331285
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 500..550
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140858
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15256
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5741
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.