Sequence 1: | NP_001285168.1 | Gene: | CG32647 / 326226 | FlyBaseID: | FBgn0052647 | Length: | 233 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_005128.1 | Gene: | DGCR2 / 9993 | HGNCID: | 2845 | Length: | 550 | Species: | Homo sapiens |
Alignment Length: | 232 | Identity: | 55/232 - (23%) |
---|---|---|---|
Similarity: | 87/232 - (37%) | Gaps: | 59/232 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 37 QTTWRRQRGCCTTTTTAAIRNMQQQKQKQQQQS------------YLQRLKAAGRL--GAWPPPM 87
Fly 88 --TSLLWLPTDYLAQLILA-----LCL-LGCL---------------------SPFTAALEEDCV 123
Fly 124 DFQGNKVNHGMLYVP-GPGVCSLCVCYHSEPLWCKAIYCDPPYFCKNFRVG-ERCCEFECLDPPG 186
Fly 187 EDKLYQERMRKRAEILAGNSTASNVQLAPIAMSTIML 223 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32647 | NP_001285168.1 | VWC | 130..178 | CDD:302663 | 16/49 (33%) |
DGCR2 | NP_005128.1 | LDLa | 30..66 | CDD:238060 | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 69..92 | ||||
CLECT_DGCR2_like | 115..267 | CDD:153069 | 22/123 (18%) | ||
VWC | 271..329 | CDD:214564 | 20/57 (35%) | ||
Atrophin-1 | <428..537 | CDD:331285 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 500..550 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165140858 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | LDO | PTHR15256 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R5741 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 4.020 |