DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32647 and dgcr2

DIOPT Version :9

Sequence 1:NP_001285168.1 Gene:CG32647 / 326226 FlyBaseID:FBgn0052647 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_012818344.1 Gene:dgcr2 / 549594 XenbaseID:XB-GENE-970772 Length:562 Species:Xenopus tropicalis


Alignment Length:114 Identity:34/114 - (29%)
Similarity:52/114 - (45%) Gaps:16/114 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 SPFTAALEEDCVDFQGNKVNHGMLYVP-GPGVCSLCVCYHSEPLWCKAIYCDPPYFCKNFRVG-E 174
            |.|.....:.|||.:.|.|:.|..:.| |...|..|.|::.||..|.|..|:.|..|:.:|.. :
 Frog   272 SSFLCKRSQTCVDIKDNIVDEGYYFTPKGDDPCLSCTCHNGEPEMCVAALCERPQGCQQYRKDPK 336

  Fly   175 RCCEFECLDPPGEDKLYQERMRKRAEILAGNSTASNVQLAPIAMSTIML 223
            .||:|.||||.|....              :|.||.::|....:|:.::
 Frog   337 ECCKFTCLDPDGSSLF--------------DSMASGMRLIVSCISSFLI 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32647NP_001285168.1 VWC 130..178 CDD:302663 16/49 (33%)
dgcr2XP_012818344.1 LDLa 41..77 CDD:238060
CLECT_DGCR2_like 126..278 CDD:153069 2/5 (40%)
VWC 282..340 CDD:214564 20/57 (35%)
Extensin_2 <435..476 CDD:252669
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.