DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32647 and CG42404

DIOPT Version :9

Sequence 1:NP_001285168.1 Gene:CG32647 / 326226 FlyBaseID:FBgn0052647 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001247118.1 Gene:CG42404 / 41842 FlyBaseID:FBgn0259823 Length:1133 Species:Drosophila melanogaster


Alignment Length:108 Identity:33/108 - (30%)
Similarity:42/108 - (38%) Gaps:31/108 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 CVDFQGNKVNHGMLYVPGPGVCSLCVCYHSEPLWCKAIYCDPPYFCKNFRV---GERCCEFECLD 183
            |.|:.|.....||.|:|||..|.||:|....|..||.:.|:....||:|:.   |..|||..|||
  Fly    29 CRDYNGKMYETGMHYMPGPDSCRLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLD 93

  Fly   184 PPGED----------------------------KLYQERMRKR 198
            ....|                            :|.|.:||.|
  Fly    94 DQFSDGSTDFGIXLVASGITATLSLSLLFFLVNRLRQRKMRAR 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32647NP_001285168.1 VWC 130..178 CDD:302663 19/50 (38%)
CG42404NP_001247118.1 VWC 32..89 CDD:214564 21/56 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CIGI
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43255
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.