DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32647 and Dgcr2

DIOPT Version :9

Sequence 1:NP_001285168.1 Gene:CG32647 / 326226 FlyBaseID:FBgn0052647 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_038944454.1 Gene:Dgcr2 / 360742 RGDID:1310567 Length:549 Species:Rattus norvegicus


Alignment Length:114 Identity:34/114 - (29%)
Similarity:51/114 - (44%) Gaps:16/114 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 SPFTAALEEDCVDFQGNKVNHGMLYVP-GPGVCSLCVCYHSEPLWCKAIYCDPPYFCKNFRVG-E 174
            |.|.....:.|||.:.|.|:.|..:.| |...|..|.|:..||..|.|..|:.|..|:.:|.. :
  Rat   260 SSFLCKRSQTCVDIKDNVVDEGFYFTPKGDDPCLSCTCHRGEPEMCVAALCERPQGCQQYRKDPK 324

  Fly   175 RCCEFECLDPPGEDKLYQERMRKRAEILAGNSTASNVQLAPIAMSTIML 223
            .||:|.||||.|....              :|.||.::|....:|:.::
  Rat   325 ECCKFMCLDPDGSSLF--------------DSMASGMRLVVSCVSSFLI 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32647NP_001285168.1 VWC 130..178 CDD:302663 16/49 (33%)
Dgcr2XP_038944454.1 LDLa 30..66 CDD:238060
CLECT_DGCR2_like 114..266 CDD:153069 2/5 (40%)
VWC 270..328 CDD:214564 20/57 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334528
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.