Sequence 1: | NP_001285168.1 | Gene: | CG32647 / 326226 | FlyBaseID: | FBgn0052647 | Length: | 233 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038944454.1 | Gene: | Dgcr2 / 360742 | RGDID: | 1310567 | Length: | 549 | Species: | Rattus norvegicus |
Alignment Length: | 114 | Identity: | 34/114 - (29%) |
---|---|---|---|
Similarity: | 51/114 - (44%) | Gaps: | 16/114 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 112 SPFTAALEEDCVDFQGNKVNHGMLYVP-GPGVCSLCVCYHSEPLWCKAIYCDPPYFCKNFRVG-E 174
Fly 175 RCCEFECLDPPGEDKLYQERMRKRAEILAGNSTASNVQLAPIAMSTIML 223 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32647 | NP_001285168.1 | VWC | 130..178 | CDD:302663 | 16/49 (33%) |
Dgcr2 | XP_038944454.1 | LDLa | 30..66 | CDD:238060 | |
CLECT_DGCR2_like | 114..266 | CDD:153069 | 2/5 (40%) | ||
VWC | 270..328 | CDD:214564 | 20/57 (35%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166334528 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |