DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32633 and CG31086

DIOPT Version :9

Sequence 1:NP_001259517.1 Gene:CG32633 / 326225 FlyBaseID:FBgn0052633 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001247312.1 Gene:CG31086 / 43179 FlyBaseID:FBgn0051086 Length:148 Species:Drosophila melanogaster


Alignment Length:141 Identity:119/141 - (84%)
Similarity:131/141 - (92%) Gaps:0/141 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADHRWMHFSNGSVPPNAVVAGHDSDGDTIYVGRAFFSNDMLPAKVIPNKGKAYVAYAREEHELE 65
            |..|.|:|||||::|..|||||||||||||::||||:.|||||||:||||||||||||.:|.|||
  Fly     1 MDGHSWLHFSNGAIPQAAVVAGHDSDGDTIFIGRAFYCNDMLPAKIIPNKGKAYVAYANQEVELE 65

  Fly    66 NYEVLSGYNYEWLSAENGEVPPGAVKVGRNVDGEYLYAGRGYHAGSLTMGKVHPSHGCLYIPYDS 130
            |||||||:|||||.||||||||||||||:|||||.|||||||||||||:||||||||||||||||
  Fly    66 NYEVLSGFNYEWLPAENGEVPPGAVKVGQNVDGETLYAGRGYHAGSLTVGKVHPSHGCLYIPYDS 130

  Fly   131 DEVKIFAYEVL 141
            :||||||||||
  Fly   131 EEVKIFAYEVL 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32633NP_001259517.1 DM9 3..73 CDD:128937 54/69 (78%)
DUF3421 24..134 CDD:288732 95/109 (87%)
DM9 74..142 CDD:128937 63/68 (93%)
DUF3421 165..275 CDD:288732
DM9 215..284 CDD:128937
CG31086NP_001247312.1 DM9 3..73 CDD:128937 54/69 (78%)
DUF3421 24..134 CDD:288732 95/109 (87%)
DM9 74..143 CDD:128937 63/68 (93%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449316
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H15731
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1154851at2759
OrthoFinder 1 1.000 - - FOG0005929
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31649
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.040

Return to query results.
Submit another query.