DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32633 and CG16775

DIOPT Version :9

Sequence 1:NP_001259517.1 Gene:CG32633 / 326225 FlyBaseID:FBgn0052633 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_649022.2 Gene:CG16775 / 39993 FlyBaseID:FBgn0036767 Length:191 Species:Drosophila melanogaster


Alignment Length:156 Identity:46/156 - (29%)
Similarity:83/156 - (53%) Gaps:12/156 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 IFAYEVLCQPERWIDTTAT-NIPDGALVAGHDSNGDTIYVGRVFRNGDLLPAKVVPAKGKAYAAY 198
            :::||     ::|:....| ::|:.|::.|.|.:|...|||||..:.::|||:|||..|||....
  Fly    25 VYSYE-----DKWVYLDKTLDLPEEAILGGVDPDGYYTYVGRVTYSSNILPARVVPELGKATYNT 84

  Fly   199 AQAEHELTDVQVLTGS---GFRWVPASHGNVAPGALSSGPNVDGEPLYVGRAIYCD-SLSVGKIH 259
            ....::.|..:||..:   |:.|:.:..|.....|:|.|.|...|.:::.| :.|| |:.:|.::
  Fly    85 DTLGNQATTYEVLVSNATVGYHWIRSFDGFREKNAVSVGTNALSERVFICR-VRCDESIFIGTLY 148

  Fly   260 PSHGCIYIPFGGEEVR-LENYEVLVR 284
            .|.....:.:....:| .:.||:|||
  Fly   149 LSKRMCIVKYDNFPLRQFDKYEILVR 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32633NP_001259517.1 DM9 3..73 CDD:128937
DUF3421 24..134 CDD:288732
DM9 74..142 CDD:128937 2/6 (33%)
DUF3421 165..275 CDD:288732 33/113 (29%)
DM9 215..284 CDD:128937 18/70 (26%)
CG16775NP_649022.2 DM9 29..100 CDD:128937 25/75 (33%)
DUF3421 51..164 CDD:288732 33/113 (29%)
DM9 104..175 CDD:128937 20/72 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449340
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005929
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31649
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.