DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32633 and CG5506

DIOPT Version :9

Sequence 1:NP_001259517.1 Gene:CG32633 / 326225 FlyBaseID:FBgn0052633 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_649021.1 Gene:CG5506 / 39992 FlyBaseID:FBgn0036766 Length:180 Species:Drosophila melanogaster


Alignment Length:152 Identity:54/152 - (35%)
Similarity:77/152 - (50%) Gaps:11/152 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DHRWMHFSNGS--VPPNAVVAGHDSDGDTIYVGRAFFSNDMLPAKVIPNKGKAYVAYAREEHELE 65
            :|.| ...|.|  :|.||||.|.|..|.|.||||..:||.:|||:|:...|.||........:|.
  Fly    25 EHVW-KAGNLSYVIPYNAVVGGFDPYGFTTYVGRVKYSNSILPARVVAETGTAYFNTETTSSKLL 88

  Fly    66 NYEVL---SGYNYEWLSAENGEVPPGAVKVGRNVDGEYLYAGRGYHAGSLTMGKVHPSHG--CLY 125
            .|::|   ...||.|:.:.:|....|||.||..|..|.::..|....|.:.:|.:..|..  |: 
  Fly    89 VYDILVAERDVNYVWVRSFDGFYEKGAVAVGTTVKNERVFCCRAKTDGGILIGTLLLSSQKVCI- 152

  Fly   126 IPYDSDEVKIF-AYEVL-CQPE 145
            |.::|..::.| .|||| .||:
  Fly   153 IKHESLALRKFDKYEVLVAQPK 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32633NP_001259517.1 DM9 3..73 CDD:128937 29/74 (39%)
DUF3421 24..134 CDD:288732 37/114 (32%)
DM9 74..142 CDD:128937 23/71 (32%)
DUF3421 165..275 CDD:288732
DM9 215..284 CDD:128937
CG5506NP_649021.1 DM9 25..96 CDD:128937 29/71 (41%)
DUF3421 47..161 CDD:288732 37/114 (32%)
DM9 100..172 CDD:128937 23/72 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449341
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005929
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31649
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.