DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32564 and CG11350

DIOPT Version :9

Sequence 1:NP_728056.1 Gene:CG32564 / 326222 FlyBaseID:FBgn0052564 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_647910.1 Gene:CG11350 / 38554 FlyBaseID:FBgn0035552 Length:456 Species:Drosophila melanogaster


Alignment Length:521 Identity:154/521 - (29%)
Similarity:193/521 - (37%) Gaps:232/521 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLYV-CVSLALLALS-APVPSDALLGAKLALLKAIGGGLGGGSSGGGGYSTGSGGYGGGYGSGG 63
            ||.:: |..:|.:|.. :.:||...|..          |.|..|:....||..|           
  Fly     1 MKFFLFCAFIAAVAADVSHLPSSQYLPP----------GRGAASAPVASYSAPS----------- 44

  Fly    64 YSGGYNQGYYNQPSRPV--YNSEYGSSSSSSASSSS-SYGGSYGGGYGGGYGGGEQVIKVIKVVE 125
                  |.|..:.|.||  |::...||.|.:||:.: ||..                        
  Fly    45 ------QSYSVEASAPVASYSAPVESSYSVAASAPAVSYAA------------------------ 79

  Fly   126 QPSYSYGR-SSGYGGNYGGYSSSASSSASANSYSAPSVSYSAPAPAVTYSAPAPAVSYSAP---- 185
             |:.||.. :..|......|  :|::||.|.||:||:.||||||...|.:|.||||||:||    
  Fly    80 -PAVSYAAPAQSYSAPAATY--TAAASAPAVSYAAPAQSYSAPAATYTAAASAPAVSYAAPAQSY 141

  Fly   186 -APAVTYSAPAPAPAVTYSAPAPVVRVQA-APAVTYSAP-------------------------- 222
             |||.||:|.|.||||||:|||......| ||||:||||                          
  Fly   142 SAPAATYTAAASAPAVTYAAPAQTYTAAASAPAVSYSAPAESYETAASEPAHTFSANDGYRYKTH 206

  Fly   223 -----------------------------------------------APAPAVTYSAPA---PAP 237
                                                           |.||||:|:|||   .||
  Fly   207 KRVVLRRHRRGVPSNDYLPPFQGAASAPTSEYLPPAASAPAPVYQSAASAPAVSYAAPAQTYSAP 271

  Fly   238 AVTYSAP----------------------------------------------------APAPVV 250
            ||:|:.|                                                    ||||  
  Fly   272 AVSYAEPAESYETAASAPAHSFSSNDGYRYKTHKRVVLRRHRRDVSHLPSNDYLPPAASAPAP-- 334

  Fly   251 RVQAAPAVTYSAPAPAVTYSAPAPAVTYSGP-----APAVTYSAPAPVPVVRYSAPA---PAPIS 307
             |.:|||.:|||||...|.:|.||||:|:.|     |||.||:|.|..|.|.||||:   .||..
  Fly   335 -VYSAPAQSYSAPAATYTAAASAPAVSYAAPAQSYSAPAATYTAAASAPAVSYSAPSQSYSAPEY 398

  Fly   308 Y---APAP-VSYAPQPQSQQVVKTIKLIVDEDRAPAQVYGPPAVESSYSSASSSAAASAGGYNGG 368
            |   |.|| |||:                    |||..|..||  .||.:|:|..|.|... |.|
  Fly   399 YSGAASAPAVSYS--------------------APAASYSAPA--ESYETAASEPAHSFSS-NDG 440

  Fly   369 Y 369
            |
  Fly   441 Y 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32564NP_728056.1 PRK12323 <165..>319 CDD:237057 97/299 (32%)
CG11350NP_647910.1 GYR 198..215 CDD:128953 0/16 (0%)
GYR 296..313 CDD:128953 0/16 (0%)
GYR 438..455 CDD:128953 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15363
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.