DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32564 and CG30457

DIOPT Version :9

Sequence 1:NP_728056.1 Gene:CG32564 / 326222 FlyBaseID:FBgn0052564 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_611198.1 Gene:CG30457 / 36940 FlyBaseID:FBgn0050457 Length:189 Species:Drosophila melanogaster


Alignment Length:186 Identity:80/186 - (43%)
Similarity:93/186 - (50%) Gaps:22/186 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 SSASANSYSAPSVSYSAPAPAVTYSAPAPAVSYSAPAPAVTYSAPAPAPA-VTYSAPAPVVRVQA 213
            |..|..:|:..|:...||.|.   :||||.  ..||||..||..|||||| |....|||.....|
  Fly    19 SHLSGYNYAPVSIPQPAPLPV---AAPAPI--KVAPAPVNTYIPPAPAPAPVQIEVPAPAPAPVA 78

  Fly   214 APAVTYSAPAPAPAVTYSAPAPAPAVTYSAPAPAPVVRVQAAPAVTYSAPAPAVTYSAPAPAVTY 278
            .||......||||..||..|||. .|...|||||||           :.||||....||||..||
  Fly    79 IPAPAPIKVAPAPVNTYIPPAPV-QVEIPAPAPAPV-----------AIPAPAPIKVAPAPVNTY 131

  Fly   279 SGPAPAVTYSAPAPVPVVRYSAPAPAPISYAPAPVSYAPQPQSQQ--VVKTIKLIV 332
            ..||| |:..||||:||....||||.|: .||.||....:|.|..  ..||::.::
  Fly   132 IPPAP-VSIPAPAPLPVKVAPAPAPVPV-LAPQPVLEEIEPVSADGYRYKTVRRVI 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32564NP_728056.1 PRK12323 <165..>319 CDD:237057 72/154 (47%)
CG30457NP_611198.1 GYR 173..188 CDD:128953 2/13 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.