DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32564 and CG11584

DIOPT Version :9

Sequence 1:NP_728056.1 Gene:CG32564 / 326222 FlyBaseID:FBgn0052564 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_572941.1 Gene:CG11584 / 32363 FlyBaseID:FBgn0030541 Length:662 Species:Drosophila melanogaster


Alignment Length:472 Identity:150/472 - (31%)
Similarity:182/472 - (38%) Gaps:223/472 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 QVIKVIKVVEQPSYSYGRSSGYGGNYGGYSSSASSSASANSYSAPS------------------- 161
            |||:....|..|:.:..:|         ||:.|.:.....:||||:                   
  Fly   198 QVIQQTYSVPAPAPAVQQS---------YSAPAPAPVVQQTYSAPAPVVQEQTYTAAAPVQAVQQ 253

  Fly   162 VSYSAPAPAVT-----------------------------YSAPAPAV--SYSAPAPA----VTY 191
            ::||||||...                             |||||||:  :|||||||    .||
  Fly   254 LTYSAPAPVTQEQYYSAPASVVQQTSSAPAPAPAPVQEQFYSAPAPAIQQTYSAPAPAPVVQQTY 318

  Fly   192 SAPAPAPAVTYSAPAPVVRVQAAPAVTYSAPAPAPAV--TYSAPAP--------------APAV- 239
            |||||||..|||||||.|:.|.....:||||||||..  |||.|||              ||.| 
  Fly   319 SAPAPAPQQTYSAPAPAVQEQTQVVQSYSAPAPAPVAQQTYSYPAPVVQQAPVVQAVAQQAPVVQ 383

  Fly   240 -TYSAPAPAPVVR-------------------VQAAPAV--TYSAPAPA----VTYSAPAPAV-- 276
             :||||||||||:                   :|.||.|  :|||||||    .:||||||.|  
  Fly   384 QSYSAPAPAPVVQQTYSAPAPVVQETIQQAPVIQQAPVVQQSYSAPAPAPVVQQSYSAPAPVVQE 448

  Fly   277 ----------------TYSGPAPAV------------------TYSAPAPVPVVR--YSAPAPAP 305
                            :||.|||.|                  :||||||.|||:  ||||||||
  Fly   449 TIQQAPVIQQAPVVQQSYSAPAPVVQETIQQAPVIQQAPVVQQSYSAPAPAPVVQQSYSAPAPAP 513

  Fly   306 I-------------SY-APAPVS-----------------------YAPQPQSQQV--------- 324
            :             || ||||||                       .||.|..|.:         
  Fly   514 VVQESIQQAPVIQQSYTAPAPVSIPEPVQQIVQQPQYSGYSYQTPQQAPAPIQQSLPAPAPVVIS 578

  Fly   325 ----------VKTIKLIVDEDRAPAQV---------YGPPAVESSYS-----------SASSSAA 359
                      |:..:..|....||.|:         |.||.|:...:           :|::..|
  Fly   579 APAPAPAPAPVQLQQSFVPAPPAPIQIQQPAQPIVQYSPPVVQQQVTYTQPAPAPIQVAAAAPVA 643

  Fly   360 ASAG---GYNGGYNGGY 373
            .||.   |.|...||||
  Fly   644 VSAPAEIGTNYAANGGY 660

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32564NP_728056.1 PRK12323 <165..>319 CDD:237057 115/306 (38%)
CG11584NP_572941.1 rne <209..408 CDD:236766 74/207 (36%)
rne <329..539 CDD:236766 84/209 (40%)
TFIIA 475..>635 CDD:281188 38/159 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15363
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.