DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32564 and CG11584

DIOPT Version :10

Sequence 1:NP_728056.1 Gene:CG32564 / 326222 FlyBaseID:FBgn0052564 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_572941.1 Gene:CG11584 / 32363 FlyBaseID:FBgn0030541 Length:662 Species:Drosophila melanogaster


Alignment Length:472 Identity:150/472 - (31%)
Similarity:182/472 - (38%) Gaps:223/472 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 QVIKVIKVVEQPSYSYGRSSGYGGNYGGYSSSASSSASANSYSAPS------------------- 161
            |||:....|..|:.:..:|         ||:.|.:.....:||||:                   
  Fly   198 QVIQQTYSVPAPAPAVQQS---------YSAPAPAPVVQQTYSAPAPVVQEQTYTAAAPVQAVQQ 253

  Fly   162 VSYSAPAPAVT-----------------------------YSAPAPAV--SYSAPAPA----VTY 191
            ::||||||...                             |||||||:  :|||||||    .||
  Fly   254 LTYSAPAPVTQEQYYSAPASVVQQTSSAPAPAPAPVQEQFYSAPAPAIQQTYSAPAPAPVVQQTY 318

  Fly   192 SAPAPAPAVTYSAPAPVVRVQAAPAVTYSAPAPAPAV--TYSAPAP--------------APAV- 239
            |||||||..|||||||.|:.|.....:||||||||..  |||.|||              ||.| 
  Fly   319 SAPAPAPQQTYSAPAPAVQEQTQVVQSYSAPAPAPVAQQTYSYPAPVVQQAPVVQAVAQQAPVVQ 383

  Fly   240 -TYSAPAPAPVVR-------------------VQAAPAV--TYSAPAPA----VTYSAPAPAV-- 276
             :||||||||||:                   :|.||.|  :|||||||    .:||||||.|  
  Fly   384 QSYSAPAPAPVVQQTYSAPAPVVQETIQQAPVIQQAPVVQQSYSAPAPAPVVQQSYSAPAPVVQE 448

  Fly   277 ----------------TYSGPAPAV------------------TYSAPAPVPVVR--YSAPAPAP 305
                            :||.|||.|                  :||||||.|||:  ||||||||
  Fly   449 TIQQAPVIQQAPVVQQSYSAPAPVVQETIQQAPVIQQAPVVQQSYSAPAPAPVVQQSYSAPAPAP 513

  Fly   306 I-------------SY-APAPVS-----------------------YAPQPQSQQV--------- 324
            :             || ||||||                       .||.|..|.:         
  Fly   514 VVQESIQQAPVIQQSYTAPAPVSIPEPVQQIVQQPQYSGYSYQTPQQAPAPIQQSLPAPAPVVIS 578

  Fly   325 ----------VKTIKLIVDEDRAPAQV---------YGPPAVESSYS-----------SASSSAA 359
                      |:..:..|....||.|:         |.||.|:...:           :|::..|
  Fly   579 APAPAPAPAPVQLQQSFVPAPPAPIQIQQPAQPIVQYSPPVVQQQVTYTQPAPAPIQVAAAAPVA 643

  Fly   360 ASAG---GYNGGYNGGY 373
            .||.   |.|...||||
  Fly   644 VSAPAEIGTNYAANGGY 660

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32564NP_728056.1 PRK12323 <165..>319 CDD:481241 115/306 (38%)
CG11584NP_572941.1 PHA03247 <208..634 CDD:223021 136/434 (31%)
rne <329..539 CDD:236766 84/209 (40%)

Return to query results.
Submit another query.